Clone FI08435 Report

Search the DGRC for FI08435

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:84
Well:35
Vector:pOTB7
Associated Gene/TranscriptCG31875-RA
Protein status:FI08435.pep: gold
Sequenced Size:1031

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31875 2008-12-18 5.12 accounting

Clone Sequence Records

FI08435.complete Sequence

1031 bp assembled on 2008-09-12

GenBank Submission: BT044405.1

> FI08435.complete
AAAACACAACACTGGATTTTTTGCCCACGGTGCTATCTTCATGTAGATTA
TTTATTTTTTTCTTTTTGTTTTGAACGAAGGATGTCGGCACGCAAGGAGA
AACGAGACATACATTACTGGCGAAAACAGGCAGCCACCTTGCCGGATTTT
GTGCCGCCGTGGAAGCGGGAACAGGATTTGCAGCAGCTGCAACATCGAGC
CTCGATCCTGTGGTCGCCGCAACTGCAGGACCAAGATGACAAGGCTGTTC
GCGAATACCTTGACTATGCGGCCAGTCTCTATGATATCGAGGAGGAGCAG
GCGCTGTTCATCCTGCGGCGTCACGGATACGACCTGCCCCTGGCACATCG
ACGTCTGGAGAAGACTGAGACAGCTCGAGGATGTCGCTACCATCGCTGGA
AGGCCGAGGATCTCATCCGTCTTACCAAGGCCTTCGAGCAATACGGCACC
GACTTCGCAAAGGTACGAAAGGAGCTACCCCACTTTCCCCTGGCCGAGCT
TCGGCTGTACTTCTCCTTCATGTCCTCGGCGTTGGAGACAGATGACCAAC
AGGCCATCCATAGATGATGCTTTGAATCGGCCTTCGTGAATTAATCCCAC
ATGGACTGTATCTTCCAAGCGCATGGTTATTTAGATTATGATAGTATTCA
AACTATTCATTGACCAACGATTGATATTAATCACTATCTATTCAACGTAA
AATGCTTTAAGTGTTATTTGTATTTTTCTAAGAATTCACGTGTTCAAAAA
AACCACACAAAATAATAGGTATTTAAATGTATTCAAGGTCATATTGAAAT
AAGACTATCAACTTCACAAAAAAGTCCTTGAATAGTAGGTAGGATTCTCA
GTATTCATAGTTAAATGATAATAAACCAATTATAACAACTGTTGATGCCA
ACCAAAAACGCATATTTAGTTGACAATTGAAAAAAAAGCATGTTGTGTAA
ATACTTTTGACCACCTCTGTATAATAAAATATACACATTTTAGTTTTTTT
GGTAAAATAATAAAAAAAAAAAAAAAAAAAA

FI08435.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:00:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG31875-RA 1012 CG31875-RA 1..1012 1..1011 4780 98.3 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:19:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 9994496..9995508 1011..1 4895 99.1 Minus
chrX 22417052 chrX 21966061..21966115 972..918 260 98.2 Minus
chr3R 27901430 chr3R 396786..396839 918..971 255 98.1 Plus
chr2RHet 3288813 chr2RHet 2334194..2334247 916..969 240 96.3 Plus
chr2L 23010047 chr2L 22353697..22353758 979..918 235 91.9 Minus
chrX 22417052 chrX 18935726..18935781 916..971 235 94.6 Plus
chr2R 21145070 chr2R 1682395..1682448 920..973 225 94.4 Plus
chr4 1351717 chr4 916298..916353 918..973 220 92.9 Plus
chr3RHet 2517486 chr3RHet 378194..378252 974..916 220 91.5 Minus
chr2L 23010047 chr2L 22354349..22354401 918..971 205 96.3 Plus
chr2L 23010047 chr2L 22720172..22720221 919..968 205 94 Plus
chr2L 23010047 chr2L 22756807..22756856 919..968 205 94 Plus
chr2L 23010047 chr2L 22766543..22766592 968..919 205 94 Minus
chr2L 23010047 chr2L 22773661..22773710 968..919 205 94 Minus
chr3R 27901430 chr3R 9200647..9200705 972..916 200 93.2 Minus
chr2R 21145070 chr2R 692704..692759 918..972 200 94.6 Plus
chr2L 23010047 chr2L 21587280..21587321 931..972 195 97.6 Plus
chr2R 21145070 chr2R 12107118..12107163 975..930 185 93.5 Minus
chr2R 21145070 chr2R 12107185..12107243 916..973 185 91.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:20:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:19:12
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9995560..9996572 1012..1 4775 98.3 Minus
X 23542271 X 22570095..22570149 972..918 260 98.2 Minus
3R 32079331 3R 4571068..4571121 918..971 255 98.1 Plus
2R 25286936 2R 3536362..3536415 916..969 240 96.3 Plus
2L 23513712 2L 22355180..22355241 979..918 235 91.9 Minus
X 23542271 X 19046768..19046823 916..971 235 94.6 Plus
2R 25286936 2R 5795007..5795060 920..973 225 94.4 Plus
3R 32079331 3R 1065826..1065884 916..974 220 91.5 Plus
4 1348131 4 895769..895824 918..973 220 92.9 Plus
2L 23513712 2L 22355831..22355883 918..971 205 96.3 Plus
2L 23513712 2L 22828946..22828995 919..968 205 94 Plus
2L 23513712 2L 22865583..22865632 919..968 205 94 Plus
2L 23513712 2L 22875319..22875368 968..919 205 94 Minus
2L 23513712 2L 22882437..22882486 968..919 205 94 Minus
2R 25286936 2R 770629..770678 919..968 205 94 Plus
2R 25286936 2R 777746..777795 919..968 205 94 Plus
2R 25286936 2R 787481..787530 968..919 205 94 Minus
2R 25286936 2R 824095..824144 968..919 205 94 Minus
2R 25286936 2R 4805134..4805189 918..972 200 94.6 Plus
2L 23513712 2L 21588785..21588826 931..972 195 97.6 Plus
3R 32079331 3R 13375469..13375526 972..916 195 93.1 Minus
2R 25286936 2R 16219796..16219841 975..930 185 93.5 Minus
2R 25286936 2R 16219863..16219921 916..973 185 91.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:19:38
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9995560..9996572 1012..1 4785 98.3 Minus
X 23527363 X 22555187..22555241 972..918 260 98.1 Minus
3R 31820162 3R 4311899..4311952 918..971 255 98.1 Plus
2R 25260384 2R 3537561..3537614 916..969 240 96.2 Plus
2L 23513712 2L 22355180..22355241 979..918 235 91.9 Minus
X 23527363 X 19054866..19054921 916..971 235 94.6 Plus
2R 25260384 2R 5796206..5796259 920..973 225 94.4 Plus
3R 31820162 3R 863404..863462 916..974 220 91.5 Plus
4 1331231 4 895769..895824 918..973 220 92.8 Plus
2L 23513712 2L 22355831..22355883 918..971 215 96.2 Plus
2R 25260384 2R 4806333..4806388 918..972 210 94.6 Plus
2L 23513712 2L 22865583..22865632 919..968 205 94 Plus
2L 23513712 2L 22828946..22828995 919..968 205 94 Plus
2L 23513712 2L 22882437..22882486 968..919 205 94 Minus
2L 23513712 2L 22875319..22875368 968..919 205 94 Minus
2R 25260384 2R 777746..777795 919..968 205 94 Plus
2R 25260384 2R 770629..770678 919..968 205 94 Plus
2R 25260384 2R 824095..824144 968..919 205 94 Minus
2R 25260384 2R 787481..787530 968..919 205 94 Minus
3R 31820162 3R 13116300..13116357 972..916 205 93.1 Minus
2L 23513712 2L 21588785..21588826 931..972 195 97.6 Plus
2R 25260384 2R 16221062..16221120 916..973 195 91.5 Plus
2L 23513712 2L 14844507..14844560 919..973 190 92.7 Plus
X 23527363 X 9565470..9565520 971..920 190 94.2 Minus
Blast to na_te.dros performed 2019-03-16 07:19:13
Subject Length Description Subject Range Query Range Score Percent Strand
Ddip\Bari1 1677 Ddip\Bari1 DDBARI1 1676bp Derived from Y13852. 1625..1677 918..970 256 98.1 Plus
Bari1 1728 Bari1 DMBARI1 1728bp AKA(S55767) Derived from X67681 (g7640) (Rel. 36, Last updated, Version 6). 1676..1728 918..970 166 79.2 Plus
Bari2 1064 Bari2 1064bp Derived from AF541951 (Rel. 73, Last updated, Version 1). 929..994 899..964 113 67.2 Plus

FI08435.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:20:17 Download gff for FI08435.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 9994496..9995508 1..1011 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:58:49 Download gff for FI08435.complete
Subject Subject Range Query Range Percent Splice Strand
CG31875-RA 1..486 82..567 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:01:07 Download gff for FI08435.complete
Subject Subject Range Query Range Percent Splice Strand
CG31875-RC 1..486 82..567 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:22:43 Download gff for FI08435.complete
Subject Subject Range Query Range Percent Splice Strand
CG31875-RB 1..486 82..567 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:31:18 Download gff for FI08435.complete
Subject Subject Range Query Range Percent Splice Strand
CG31875-RB 1..486 82..567 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:19:23 Download gff for FI08435.complete
Subject Subject Range Query Range Percent Splice Strand
CG31875-RA 1..1012 1..1011 98   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:01:07 Download gff for FI08435.complete
Subject Subject Range Query Range Percent Splice Strand
CG31875-RA 1..1012 1..1011 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:22:43 Download gff for FI08435.complete
Subject Subject Range Query Range Percent Splice Strand
CG31875-RA 1..1012 1..1011 98   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-12 15:54:58 Download gff for FI08435.complete
Subject Subject Range Query Range Percent Splice Strand
CG31875-RA 1..1012 1..1011 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:31:18 Download gff for FI08435.complete
Subject Subject Range Query Range Percent Splice Strand
CG31875-RA 1..1012 1..1011 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:20:17 Download gff for FI08435.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9995561..9996572 1..1011 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:20:17 Download gff for FI08435.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9995561..9996572 1..1011 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:20:17 Download gff for FI08435.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9995561..9996572 1..1011 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:22:43 Download gff for FI08435.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9995561..9996572 1..1011 98   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:28:22 Download gff for FI08435.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9995561..9996572 1..1011 98   Minus

FI08435.pep Sequence

Translation from 0 to 566

> FI08435.pep
KTQHWIFCPRCYLHVDYLFFSFCFERRMSARKEKRDIHYWRKQAATLPDF
VPPWKREQDLQQLQHRASILWSPQLQDQDDKAVREYLDYAASLYDIEEEQ
ALFILRRHGYDLPLAHRRLEKTETARGCRYHRWKAEDLIRLTKAFEQYGT
DFAKVRKELPHFPLAELRLYFSFMSSALETDDQQAIHR*

FI08435.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 12:41:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14142-PA 151 GF14142-PA 6..151 32..177 530 67.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:17:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG31875-PD 161 CG31875-PD 1..161 28..188 856 100 Plus
CG31875-PC 161 CG31875-PC 1..161 28..188 856 100 Plus
CG31875-PB 161 CG31875-PB 1..161 28..188 856 100 Plus
CG31875-PA 161 CG31875-PA 1..161 28..188 856 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 12:41:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12057-PA 150 GM12057-PA 1..150 28..177 743 94.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 12:41:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22313-PA 150 GD22313-PA 1..150 28..177 746 94.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 12:41:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10060-PA 150 GE10060-PA 1..150 28..177 677 84.7 Plus

FI08435.hyp Sequence

Translation from 0 to 566

> FI08435.hyp
KTQHWIFCPRCYLHVDYLFFSFCFERRMSARKEKRDIHYWRKQAATLPDF
VPPWKREQDLQQLQHRASILWSPQLQDQDDKAVREYLDYAASLYDIEEEQ
ALFILRRHGYDLPLAHRRLEKTETARGCRYHRWKAEDLIRLTKAFEQYGT
DFAKVRKELPHFPLAELRLYFSFMSSALETDDQQAIHR*

FI08435.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:42:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG31875-PD 161 CG31875-PD 1..161 28..188 856 100 Plus
CG31875-PC 161 CG31875-PC 1..161 28..188 856 100 Plus
CG31875-PB 161 CG31875-PB 1..161 28..188 856 100 Plus
CG31875-PA 161 CG31875-PA 1..161 28..188 856 100 Plus