Clone FI08527 Report

Search the DGRC for FI08527

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:85
Well:27
Vector:pOTB7
Associated Gene/TranscriptCG30355-RA
Protein status:FI08527.pep: gold
Sequenced Size:710

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG30355 2008-08-15 Release 5.9 accounting
CG30355 2008-12-18 5.12 accounting

Clone Sequence Records

FI08527.complete Sequence

710 bp assembled on 2008-07-28

GenBank Submission: BT032671

> FI08527.complete
CGGTAAACAGAAAGAACTCTTTCCAAATTGTGTAGGGTGATTTTTTAGTT
CAGACACCATTCGAAATGGCTGAAGTCCTAGAGGAATTCATCACCCTAAC
GCCCTTGACTTGTGTGCAACAATGCAATGCTTTACTAGGCTCAACATCAG
GAAAGCCGAGAAGCTGCTCCGTATTTTTTACACTATTTGGCGTATACTGC
GGCGTTCTCATCTTTCGGGCGTATCGCACATATTCCTCTAAGCAAGAAAG
AGACGAGGAAAAGATAACCGAAGGAGTTACCCTTGAGGCTAAGGAGGAAG
ATTTGATCATAGGACCTGGTTCCAGTCTTGTGAACGAATATGTAGAACAA
ACGAAGCCGATTCTGTTGCAACCCGTCGGTTTTTCCAGTACTGACATGAG
ATGGCGCTATTGCAACCACTTGCCGGAAGCAGAATTAGCACAAGGCTCTG
ATAGTGAAAACAGATCAACCGAAAGAGATGACATTGATAACCTCGAAAGG
ATGAGCAATGTTGTGGATGATAATGATGCGCAGAAGCCAGTTGCATCCAC
ATCGATGGCAACGGCTCGGGCGCCTGAGGATAACGCCGATGGTGAGCACG
TCGAGCCCACACCATTTTCGGTGTGAAACACGATGCATTTTAGCAAATTT
ATCGTGTAATTGACATTGAAATAAATCATCTTTTAAGACCCTTAAAAAAA
AAAAAAAAAA

FI08527.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:02:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG30355-RA 765 CG30355-RA 66..756 1..693 3380 99.4 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:31:36
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 4567075..4567474 400..1 2000 100 Minus
chr2R 21145070 chr2R 4566727..4567019 693..399 1380 98.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:21:08 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:31:34
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8679494..8679893 400..1 2000 100 Minus
2R 25286936 2R 8679146..8679438 693..399 1380 98.6 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:20:54
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 8680693..8681092 400..1 2000 100 Minus
2R 25260384 2R 8680345..8680637 693..399 1390 98.6 Minus
Blast to na_te.dros performed on 2019-03-15 23:31:34 has no hits.

FI08527.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:32:12 Download gff for FI08527.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 4566727..4567017 401..693 98 <- Minus
chr2R 4567075..4567474 1..400 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:59:00 Download gff for FI08527.complete
Subject Subject Range Query Range Percent Splice Strand
CG30355-RA 1..561 66..626 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:03:09 Download gff for FI08527.complete
Subject Subject Range Query Range Percent Splice Strand
CG30355-RA 1..561 66..626 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:50:50 Download gff for FI08527.complete
Subject Subject Range Query Range Percent Splice Strand
CG30355-RA 1..561 66..626 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:51:23 Download gff for FI08527.complete
Subject Subject Range Query Range Percent Splice Strand
CG30355-RA 1..561 66..626 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:39:00 Download gff for FI08527.complete
Subject Subject Range Query Range Percent Splice Strand
CG30355-RA 1..561 66..626 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:22:38 Download gff for FI08527.complete
Subject Subject Range Query Range Percent Splice Strand
CG30355-RA 56..746 1..693 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:03:09 Download gff for FI08527.complete
Subject Subject Range Query Range Percent Splice Strand
CG30355-RA 56..746 1..693 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:50:50 Download gff for FI08527.complete
Subject Subject Range Query Range Percent Splice Strand
CG30355-RA 61..751 1..693 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-28 11:20:52 Download gff for FI08527.complete
Subject Subject Range Query Range Percent Splice Strand
CG30355-RA 56..746 1..693 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:39:00 Download gff for FI08527.complete
Subject Subject Range Query Range Percent Splice Strand
CG30355-RA 61..751 1..693 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:32:12 Download gff for FI08527.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8679146..8679436 401..693 98 <- Minus
2R 8679494..8679893 1..400 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:32:12 Download gff for FI08527.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8679146..8679436 401..693 98 <- Minus
2R 8679494..8679893 1..400 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:32:12 Download gff for FI08527.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8679146..8679436 401..693 98 <- Minus
2R 8679494..8679893 1..400 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:50:50 Download gff for FI08527.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4566651..4566941 401..693 98 <- Minus
arm_2R 4566999..4567398 1..400 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:31:08 Download gff for FI08527.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8680345..8680635 401..693 98 <- Minus
2R 8680693..8681092 1..400 100   Minus

FI08527.pep Sequence

Translation from 65 to 625

> FI08527.pep
MAEVLEEFITLTPLTCVQQCNALLGSTSGKPRSCSVFFTLFGVYCGVLIF
RAYRTYSSKQERDEEKITEGVTLEAKEEDLIIGPGSSLVNEYVEQTKPIL
LQPVGFSSTDMRWRYCNHLPEAELAQGSDSENRSTERDDIDNLERMSNVV
DDNDAQKPVASTSMATARAPEDNADGEHVEPTPFSV*

FI08527.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:41:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12571-PA 181 GF12571-PA 1..146 1..158 317 45.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:41:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10626-PA 184 GG10626-PA 1..184 1..186 705 75.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:41:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24295-PA 117 GH24295-PA 1..59 1..61 163 54.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:45:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG30355-PA 186 CG30355-PA 1..186 1..186 964 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:41:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17368-PA 114 GL17368-PA 1..65 1..65 212 55.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:41:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15781-PB 147 GA15781-PB 1..144 1..180 230 32.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:41:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20671-PA 186 GM20671-PA 1..186 1..186 909 92.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:41:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10148-PA 186 GD10148-PA 1..186 1..186 905 91.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:41:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17038-PA 119 GJ17038-PA 3..61 1..61 179 57.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:41:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21572-PA 118 GK21572-PA 4..61 5..62 188 56.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:41:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22840-PA 186 GE22840-PA 1..186 1..186 788 80.6 Plus

FI08527.hyp Sequence

Translation from 65 to 625

> FI08527.hyp
MAEVLEEFITLTPLTCVQQCNALLGSTSGKPRSCSVFFTLFGVYCGVLIF
RAYRTYSSKQERDEEKITEGVTLEAKEEDLIIGPGSSLVNEYVEQTKPIL
LQPVGFSSTDMRWRYCNHLPEAELAQGSDSENRSTERDDIDNLERMSNVV
DDNDAQKPVASTSMATARAPEDNADGEHVEPTPFSV*

FI08527.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:43:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG30355-PA 186 CG30355-PA 1..186 1..186 964 100 Plus