Clone FI08802 Report

Search the DGRC for FI08802

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:88
Well:2
Vector:pBS SK-
Associated Gene/TranscriptCG5515-RA
Protein status:FI08802.pep: gold
Sequenced Size:894

Clone Sequence Records

FI08802.complete Sequence

894 bp assembled on 2009-08-11

GenBank Submission: BT099549.1

> FI08802.complete
CGGCGGCGACCGGATTTGTCTTATTTGTTTGTTGAAATTGTTAAAGCTAT
TAAATTTGCAAAATGAGCCGCAACTACAAGGAAGATCAGACCAACGAGGT
CGAGGCGTTGGACTCCATATACTGTGGCGATATGGAGATTCTCGCCACGG
AGCCGCACCACAAATTCCAGATTCCAATTGCCACGGAGGAGTACAGTTCG
GAGGAGCCCGAGAAAGGTCTTGCCTGCAAACTGGTCTTCACATTCACAGC
TACCTATCCGGATGGAGCACCCGTGGTGGAAATCGAGGAGCCAGAAAACT
TTGAGGACATGTTTGAAACGCGCCTCCTGGAACACCTGCAAAAGACAATT
GAGGAGAACCTGGGCATGGAGATGATCTTTTCGCTGGTAAGCAGCGCCCA
GGAGTGGCTGAACGAGCGGTGGGATGAACACAAGTTCCACCAGGAGGAAC
TGCGAGAGCAGAAGCTGCGGGAAATCGAAGAGGAGGAACGCAAGAAGTTT
GAGGGCACCCGTGTGACGGTGGAGTCCTTCCTCAAATGGAAGCTCGAATT
CGAGGAGAGCACCGGCATTGCCGCCAAGCGGGAGAAGAACAATGTGTCCA
AGAAGCAGACCGGACGCGAACTCTTTATGTGCGACAACACGCTCAACGAT
TCGGATATCAAGTTCCTCCTGGAGGCGGGTGAAAACATTGAAAATGTCAA
AATCGATGAGACGCTGTTCCAGGATATTGGCGAATTGGATTTGGATGACG
ATGATGATGAGGATTGGGTGCCCGGGGCGGACGACGACGACGATTAAGCT
ACAAACTGTGTCAAACTACTCAAAGGCAAATTCGTGTATTTTATATAACA
TTAAATGCCAACTTCTTTATTAATCTAAAAAAAAAAAAAAAAAA

FI08802.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:30:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG5515-RA 1206 CG5515-RA 289..1166 1..878 4390 100 Plus
CG5515.a 1087 CG5515.a 170..1047 1..878 4390 100 Plus
CG5515-RB 1077 CG5515-RB 206..1037 47..878 4160 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:17:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 20011049..20011786 876..139 3690 100 Minus
chr3R 27901430 chr3R 20011841..20011978 138..1 690 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:21:15 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:17:24
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24187722..24188461 878..139 3700 100 Minus
3R 32079331 3R 24188516..24188653 138..1 690 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:25:54
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 23928553..23929292 878..139 3700 100 Minus
3R 31820162 3R 23929347..23929484 138..1 690 100 Minus
Blast to na_te.dros performed 2019-03-16 02:17:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 367..430 427..490 122 65.6 Plus

FI08802.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:18:11 Download gff for FI08802.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 20011049..20011786 139..876 100 <- Minus
chr3R 20011841..20011978 1..138 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:13:40 Download gff for FI08802.complete
Subject Subject Range Query Range Percent Splice Strand
CG5515-RB 1..735 63..797 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:57:53 Download gff for FI08802.complete
Subject Subject Range Query Range Percent Splice Strand
CG5515-RB 1..735 63..797 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:44:14 Download gff for FI08802.complete
Subject Subject Range Query Range Percent Splice Strand
CG5515-RA 1..735 63..797 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:04:09 Download gff for FI08802.complete
Subject Subject Range Query Range Percent Splice Strand
CG5515-RB 1..735 63..797 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-08-11 14:58:57 Download gff for FI08802.complete
Subject Subject Range Query Range Percent Splice Strand
CG5515-RA 289..1164 1..876 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:57:53 Download gff for FI08802.complete
Subject Subject Range Query Range Percent Splice Strand
CG5515-RA 289..1164 1..876 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:44:14 Download gff for FI08802.complete
Subject Subject Range Query Range Percent Splice Strand
CG5515-RA 244..1119 1..876 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:04:09 Download gff for FI08802.complete
Subject Subject Range Query Range Percent Splice Strand
CG5515-RA 244..1119 1..876 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:18:11 Download gff for FI08802.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24187724..24188461 139..876 100 <- Minus
3R 24188516..24188653 1..138 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:18:11 Download gff for FI08802.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24187724..24188461 139..876 100 <- Minus
3R 24188516..24188653 1..138 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:18:11 Download gff for FI08802.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24187724..24188461 139..876 100 <- Minus
3R 24188516..24188653 1..138 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:44:14 Download gff for FI08802.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20013446..20014183 139..876 100 <- Minus
arm_3R 20014238..20014375 1..138 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:49:29 Download gff for FI08802.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23928555..23929292 139..876 100 <- Minus
3R 23929347..23929484 1..138 100   Minus

FI08802.pep Sequence

Translation from 62 to 796

> FI08802.pep
MSRNYKEDQTNEVEALDSIYCGDMEILATEPHHKFQIPIATEEYSSEEPE
KGLACKLVFTFTATYPDGAPVVEIEEPENFEDMFETRLLEHLQKTIEENL
GMEMIFSLVSSAQEWLNERWDEHKFHQEELREQKLREIEEEERKKFEGTR
VTVESFLKWKLEFEESTGIAAKREKNNVSKKQTGRELFMCDNTLNDSDIK
FLLEAGENIENVKIDETLFQDIGELDLDDDDDEDWVPGADDDDD*

FI08802.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:48:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18889-PA 246 GF18889-PA 1..246 1..244 980 85.8 Plus
Dana\GF13420-PA 192 GF13420-PA 62..182 2..117 170 32 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:48:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12365-PA 244 GG12365-PA 1..244 1..244 1244 96.7 Plus
Dere\GG22214-PA 148 GG22214-PA 29..140 3..117 155 31.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 16:48:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18921-PA 247 GH18921-PA 1..247 1..243 976 80.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:13:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG5515-PD 244 CG5515-PD 1..244 1..244 1284 100 Plus
CG5515-PC 244 CG5515-PC 1..244 1..244 1284 100 Plus
CG5515-PB 244 CG5515-PB 1..244 1..244 1284 100 Plus
CG5515-PA 244 CG5515-PA 1..244 1..244 1284 100 Plus
CG15605-PA 152 CG15605-PA 25..152 2..125 159 30.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 16:48:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23423-PA 247 GI23423-PA 1..247 1..244 960 83 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 16:48:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24135-PA 244 GL24135-PA 1..244 1..244 974 85.7 Plus
Dper\GL17236-PA 164 GL17236-PA 30..123 26..118 152 29.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 16:48:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18941-PA 244 GA18941-PA 1..244 1..244 981 86.1 Plus
Dpse\GA25052-PA 144 GA25052-PA 30..123 26..118 151 29.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:48:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23504-PA 244 GM23504-PA 1..244 1..244 1254 98.4 Plus
Dsec\GM20002-PA 152 GM20002-PA 25..152 2..125 173 31.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:48:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18314-PA 244 GD18314-PA 1..244 1..244 1254 98.4 Plus
Dsim\GD25492-PA 152 GD25492-PA 25..152 2..125 173 31.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 16:48:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14527-PA 247 GJ14527-PA 1..247 1..244 1006 83 Plus
Dvir\GJ20714-PA 136 GJ20714-PA 16..136 1..123 165 32.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 16:48:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11717-PA 244 GK11717-PA 1..244 1..241 976 80.7 Plus
Dwil\GK18885-PA 140 GK18885-PA 40..130 26..117 151 34.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:48:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10819-PA 244 GE10819-PA 1..244 1..244 1111 95.9 Plus
Dyak\GE14211-PA 152 GE14211-PA 24..152 1..125 161 30.8 Plus

FI08802.hyp Sequence

Translation from 62 to 796

> FI08802.hyp
MSRNYKEDQTNEVEALDSIYCGDMEILATEPHHKFQIPIATEEYSSEEPE
KGLACKLVFTFTATYPDGAPVVEIEEPENFEDMFETRLLEHLQKTIEENL
GMEMIFSLVSSAQEWLNERWDEHKFHQEELREQKLREIEEEERKKFEGTR
VTVESFLKWKLEFEESTGIAAKREKNNVSKKQTGRELFMCDNTLNDSDIK
FLLEAGENIENVKIDETLFQDIGELDLDDDDDEDWVPGADDDDD*

FI08802.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:43:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG5515-PD 244 CG5515-PD 1..244 1..244 1284 100 Plus
CG5515-PC 244 CG5515-PC 1..244 1..244 1284 100 Plus
CG5515-PB 244 CG5515-PB 1..244 1..244 1284 100 Plus
CG5515-PA 244 CG5515-PA 1..244 1..244 1284 100 Plus
CG15605-PA 152 CG15605-PA 25..152 2..125 159 30.2 Plus