Clone FI08808 Report

Search the DGRC for FI08808

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:88
Well:8
Vector:pBS SK-
Associated Gene/TranscriptArl2-RA
Protein status:FI08808.pep: gold
Sequenced Size:683

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Arf84F 2008-08-15 Release 5.9 accounting
Arf84F 2008-12-18 5.12 accounting

Clone Sequence Records

FI08808.complete Sequence

683 bp assembled on 2008-08-22

GenBank Submission: BT044414.1

> FI08808.complete
TTTAATAAACAATTTAAGCAGCTGCCAATAAAAACATTTGTTTATAATTC
CATAGCGTTACTAAAATACAGACGTTGTCATGGGCTTCCTCACAGTATTA
AAAAAGATGCGACAGAAGGAAAGGGAAATGCGCATATTACTGCTAGGTCT
GGATAATGCCGGCAAGACGACAATCCTGAAGCGCTTTAATGGCGAACCCA
TAGACACCATCTCACCCACACTGGGATTCAATATTAAAACCTTGGAGCAC
AACGGCTACACCCTGAATATGTGGGATGTCGGTGGCCAGAAGTCTCTGCG
ATCCTACTGGAGAAACTACTTCGAGTCCACTGATGGTCTGGTCTGGGTGG
TGGATAGCGCTGACAGGATGCGCCTAGAGTCCTGCGGCCAGGAGCTGCAA
GTTCTGCTCCAGGAAGAGCGATTAGCTGGAGCCACACTCCTAGTTCTCTG
CAACAAACAGGATCTACCGGGAGCCCTCTCATCCAACGAAATTAAAGAGA
TACTACACCTAGAGGATATCACCACACATCATTGGCTGGTGGCCGGAGTT
AGTGCAGTGACTGGCGAGAAACTGCTTAGCTCCATGGACTGGTTGATCGC
CGATATAGCTAAGCGTATATTCACTTTGGATTAAATACAATTTATTTTAC
TTCCTTAAAAAAAAAAAAAAAAAAAAAAAAAAA

FI08808.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:07:40
Subject Length Description Subject Range Query Range Score Percent Strand
Arf84F-RA 698 Arf84F-RA 29..685 1..657 3285 100 Plus
Arf84F.b 684 Arf84F.b 67..671 53..657 3025 100 Plus
Arf84F.a 684 Arf84F.a 69..671 55..657 3015 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:37:31
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 4167316..4167670 145..499 1775 100 Plus
chr3R 27901430 chr3R 4167727..4167885 498..656 795 100 Plus
chr3R 27901430 chr3R 4167113..4167256 1..144 720 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:21:18 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:37:29
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8341303..8341657 145..499 1775 100 Plus
3R 32079331 3R 8341714..8341873 498..657 800 100 Plus
3R 32079331 3R 8341100..8341243 1..144 720 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:25:50
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 8082134..8082488 145..499 1775 100 Plus
3R 31820162 3R 8082545..8082704 498..657 800 100 Plus
3R 31820162 3R 8081931..8082074 1..144 720 100 Plus
2L 23513712 2L 11541217..11541253 683..647 185 100 Minus
2R 25260384 2R 2169339..2169375 647..683 185 100 Plus
Blast to na_te.dros performed on 2019-03-16 20:37:29 has no hits.

FI08808.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:38:31 Download gff for FI08808.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 4167113..4167256 1..144 100 -> Plus
chr3R 4167316..4167670 145..499 100 -> Plus
chr3R 4167729..4167885 500..656 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:59:15 Download gff for FI08808.complete
Subject Subject Range Query Range Percent Splice Strand
Arf84F-RA 1..555 80..634 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:11:09 Download gff for FI08808.complete
Subject Subject Range Query Range Percent Splice Strand
Arf84F-RA 1..555 80..634 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:11:29 Download gff for FI08808.complete
Subject Subject Range Query Range Percent Splice Strand
Arl2-RA 1..555 80..634 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:19:43 Download gff for FI08808.complete
Subject Subject Range Query Range Percent Splice Strand
Arf84F-RA 1..555 80..634 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:08:08 Download gff for FI08808.complete
Subject Subject Range Query Range Percent Splice Strand
Arl2-RA 1..555 80..634 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:08:09 Download gff for FI08808.complete
Subject Subject Range Query Range Percent Splice Strand
Arf84F-RA 1..656 1..656 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:11:09 Download gff for FI08808.complete
Subject Subject Range Query Range Percent Splice Strand
Arf84F-RA 1..656 1..656 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:11:29 Download gff for FI08808.complete
Subject Subject Range Query Range Percent Splice Strand
Arl2-RA 1..656 1..656 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-25 10:58:36 Download gff for FI08808.complete
Subject Subject Range Query Range Percent Splice Strand
Arf84F-RA 1..656 1..656 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:08:08 Download gff for FI08808.complete
Subject Subject Range Query Range Percent Splice Strand
Arl2-RA 1..656 1..656 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:38:31 Download gff for FI08808.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8341100..8341243 1..144 100 -> Plus
3R 8341303..8341657 145..499 100 -> Plus
3R 8341716..8341872 500..656 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:38:31 Download gff for FI08808.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8341100..8341243 1..144 100 -> Plus
3R 8341303..8341657 145..499 100 -> Plus
3R 8341716..8341872 500..656 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:38:31 Download gff for FI08808.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8341100..8341243 1..144 100 -> Plus
3R 8341303..8341657 145..499 100 -> Plus
3R 8341716..8341872 500..656 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:11:29 Download gff for FI08808.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4166822..4166965 1..144 100 -> Plus
arm_3R 4167025..4167379 145..499 100 -> Plus
arm_3R 4167438..4167594 500..656 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:41:21 Download gff for FI08808.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8082134..8082488 145..499 100 -> Plus
3R 8082547..8082703 500..656 100   Plus
3R 8081931..8082074 1..144 100 -> Plus

FI08808.hyp Sequence

Translation from 79 to 633

> FI08808.hyp
MGFLTVLKKMRQKEREMRILLLGLDNAGKTTILKRFNGEPIDTISPTLGF
NIKTLEHNGYTLNMWDVGGQKSLRSYWRNYFESTDGLVWVVDSADRMRLE
SCGQELQVLLQEERLAGATLLVLCNKQDLPGALSSNEIKEILHLEDITTH
HWLVAGVSAVTGEKLLSSMDWLIADIAKRIFTLD*

FI08808.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:43:46
Subject Length Description Subject Range Query Range Score Percent Strand
Arl2-PA 184 CG7435-PA 1..184 1..184 950 100 Plus
dnd-PA 179 CG6560-PA 1..179 1..178 440 46.9 Plus
Arf102F-PB 180 CG11027-PB 15..180 14..179 410 45.8 Plus
Arf102F-PA 180 CG11027-PA 15..180 14..179 410 45.8 Plus
Arf79F-PJ 182 CG8385-PJ 15..173 14..172 383 44.7 Plus

FI08808.pep Sequence

Translation from 79 to 633

> FI08808.pep
MGFLTVLKKMRQKEREMRILLLGLDNAGKTTILKRFNGEPIDTISPTLGF
NIKTLEHNGYTLNMWDVGGQKSLRSYWRNYFESTDGLVWVVDSADRMRLE
SCGQELQVLLQEERLAGATLLVLCNKQDLPGALSSNEIKEILHLEDITTH
HWLVAGVSAVTGEKLLSSMDWLIADIAKRIFTLD*

FI08808.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 17:12:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18345-PA 184 GF18345-PA 1..184 1..184 946 97.3 Plus
Dana\GF16955-PA 184 GF16955-PA 7..184 2..178 445 46.1 Plus
Dana\GF23416-PA 180 GF23416-PA 15..180 14..179 425 47 Plus
Dana\GF24106-PA 180 GF24106-PA 15..179 15..179 390 47.6 Plus
Dana\GF23441-PA 182 GF23441-PA 15..173 14..172 384 44.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 17:12:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10035-PA 157 GG10035-PA 1..157 1..159 732 88.9 Plus
Dere\GG12548-PA 179 GG12548-PA 1..179 1..178 453 46.9 Plus
Dere\GG16407-PA 180 GG16407-PA 15..180 14..179 411 45.2 Plus
Dere\GG15940-PA 190 GG15940-PA 25..189 15..179 390 47.6 Plus
Dere\GG13164-PA 182 GG13164-PA 15..173 14..172 384 44.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 17:12:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14228-PA 184 GH14228-PA 1..184 1..184 916 94 Plus
Dgri\GH19902-PA 183 GH19902-PA 12..183 8..178 439 47.7 Plus
Dgri\GH23951-PA 180 GH23951-PA 15..180 14..179 424 47 Plus
Dgri\GH14778-PA 180 GH14778-PA 15..179 15..179 390 47.6 Plus
Dgri\GH14762-PA 182 GH14762-PA 15..173 14..172 384 44.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:10:47
Subject Length Description Subject Range Query Range Score Percent Strand
Arl2-PA 184 CG7435-PA 1..184 1..184 950 100 Plus
dnd-PA 179 CG6560-PA 1..179 1..178 440 46.9 Plus
Arf102F-PB 180 CG11027-PB 15..180 14..179 410 45.8 Plus
Arf102F-PA 180 CG11027-PA 15..180 14..179 410 45.8 Plus
Arf79F-PJ 182 CG8385-PJ 15..173 14..172 383 44.7 Plus
Arf79F-PI 182 CG8385-PI 15..173 14..172 383 44.7 Plus
Arf79F-PH 182 CG8385-PH 15..173 14..172 383 44.7 Plus
Arf79F-PF 182 CG8385-PF 15..173 14..172 383 44.7 Plus
Arf79F-PC 182 CG8385-PC 15..173 14..172 383 44.7 Plus
Arf79F-PE 182 CG8385-PE 15..173 14..172 383 44.7 Plus
Arf79F-PB 182 CG8385-PB 15..173 14..172 383 44.7 Plus
Arf79F-PA 182 CG8385-PA 15..173 14..172 383 44.7 Plus
Arl1-PA 180 CG6025-PA 15..179 15..179 381 46.1 Plus
Arf51F-PE 175 CG8156-PE 12..172 15..175 353 43.2 Plus
Arf51F-PA 175 CG8156-PA 12..172 15..175 353 43.2 Plus
Arf51F-PC 175 CG8156-PC 12..172 15..175 353 43.2 Plus
Arf51F-PB 175 CG8156-PB 12..172 15..175 353 43.2 Plus
Arf51F-PD 175 CG8156-PD 12..172 15..175 353 43.2 Plus
Arl5-PA 179 CG7197-PA 16..179 16..179 338 40.9 Plus
Arfrp1-PA 200 CG7039-PA 10..189 8..178 296 37 Plus
Arl8-PC 186 CG7891-PC 18..178 14..173 275 35.4 Plus
Arl8-PB 186 CG7891-PB 18..178 14..173 275 35.4 Plus
Arl8-PA 186 CG7891-PA 18..178 14..173 275 35.4 Plus
Arl4-PB 313 CG2219-PB 15..161 6..147 254 36.1 Plus
Arl4-PA 312 CG2219-PA 25..160 17..147 252 38.2 Plus
Arl6-PB 201 CG7735-PB 1..179 1..173 251 34.1 Plus
Arl6-PA 202 CG7735-PA 1..180 1..173 250 33.9 Plus
Sar1-PE 193 CG7073-PE 7..159 3..155 237 34.6 Plus
Sar1-PC 193 CG7073-PC 7..159 3..155 237 34.6 Plus
Sar1-PD 193 CG7073-PD 7..159 3..155 237 34.6 Plus
Sar1-PA 193 CG7073-PA 7..159 3..155 237 34.6 Plus
CG17819-PA 186 CG17819-PA 23..177 19..172 219 30.4 Plus
Arl4-PC 100 CG2219-PC 25..93 17..80 137 40.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 17:12:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24871-PA 184 GI24871-PA 1..184 1..184 917 94 Plus
Dmoj\GI22038-PA 437 GI22038-PA 260..437 2..178 453 48.3 Plus
Dmoj\GI14031-PA 180 GI14031-PA 15..180 14..179 424 47 Plus
Dmoj\GI11881-PA 180 GI11881-PA 15..179 15..179 391 47.6 Plus
Dmoj\GI11864-PA 182 GI11864-PA 15..173 14..172 384 44.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 17:12:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23431-PA 184 GL23431-PA 1..184 1..184 908 93.5 Plus
Dper\GL23729-PA 182 GL23729-PA 18..182 14..178 434 47.9 Plus
Dper\GL18404-PA 180 GL18404-PA 15..180 14..179 416 45.8 Plus
Dper\GL12747-PA 180 GL12747-PA 15..179 15..179 391 47.6 Plus
Dper\GL25178-PA 182 GL25178-PA 15..173 14..172 384 44.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 17:12:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20349-PA 184 GA20349-PA 1..184 1..184 908 93.5 Plus
Dpse\GA19685-PA 182 GA19685-PA 18..182 14..178 434 47.9 Plus
Dpse\GA10714-PA 180 GA10714-PA 15..180 14..179 416 45.8 Plus
Dpse\GA19306-PA 180 GA19306-PA 15..179 15..179 391 47.6 Plus
Dpse\GA21036-PA 182 GA21036-PA 15..173 14..172 384 44.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 17:12:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23726-PA 184 GM23726-PA 1..184 1..184 950 97.8 Plus
Dsec\GM23682-PA 179 GM23682-PA 1..179 1..178 451 46.9 Plus
Dsec\GM13026-PA 180 GM13026-PA 15..180 14..179 413 45.8 Plus
Dsec\GM25571-PA 180 GM25571-PA 15..179 15..179 390 47.6 Plus
Dsec\GM22073-PA 182 GM22073-PA 15..173 14..172 384 44.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 17:12:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18536-PA 184 GD18536-PA 1..184 1..184 953 98.4 Plus
Dsim\GD18491-PA 179 GD18491-PA 1..179 1..178 451 46.9 Plus
Dsim\GD20493-PA 180 GD20493-PA 15..180 14..179 413 45.8 Plus
Dsim\GD14586-PA 180 GD14586-PA 15..179 15..179 390 47.6 Plus
Dsim\GD12049-PA 182 GD12049-PA 15..173 14..172 384 44.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 17:12:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24514-PA 184 GJ24514-PA 1..184 1..184 908 92.9 Plus
Dvir\GJ24091-PA 179 GJ24091-PA 1..179 1..178 458 48.6 Plus
Dvir\GJ19602-PA 180 GJ19602-PA 15..180 14..179 424 47 Plus
Dvir\GJ13575-PA 180 GJ13575-PA 15..179 15..179 390 47.6 Plus
Dvir\GJ13559-PA 182 GJ13559-PA 15..173 14..172 384 44.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 17:12:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13183-PA 184 GK13183-PA 1..184 1..184 920 94.6 Plus
Dwil\GK13011-PA 193 GK13011-PA 22..193 8..178 434 47.7 Plus
Dwil\GK13623-PA 180 GK13623-PA 15..180 14..179 425 47 Plus
Dwil\GK24495-PA 167 GK24495-PA 2..166 15..179 391 47.6 Plus
Dwil\GK20496-PA 182 GK20496-PA 15..173 14..172 384 44.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 17:12:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25871-PA 184 GE25871-PA 1..184 1..184 955 98.4 Plus
Dyak\GE24074-PA 179 GE24074-PA 1..179 1..178 453 46.9 Plus
Dyak\Arf102F-PA 180 GE14567-PA 15..180 14..179 410 45.2 Plus
Dyak\GE22880-PA 180 GE22880-PA 15..179 15..179 390 47.6 Plus
Dyak\GE19486-PA 182 GE19486-PA 15..173 14..172 384 44.7 Plus