Clone FI09201 Report

Search the DGRC for FI09201

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:92
Well:1
Vector:pFlc-1
Associated Gene/TranscriptCG6421-RA
Protein status:FI09201.pep: gold
Sequenced Size:616

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6421 2008-08-15 Release 5.9 accounting
CG6421 2008-12-18 5.12 accounting

Clone Sequence Records

FI09201.complete Sequence

616 bp assembled on 2008-07-24

GenBank Submission: BT032883

> FI09201.complete
GATTCGCAGTTTCAGGGGCAGAGGAATTGGATGTTATTACTTTAACCAGC
CGGAAAATGCGAGTTTTCCTGCTATATTCCATATATTTGCTGCTGGTGCT
GTCGCCTTCATTGGTTCAAGGCCAAGGTCATGTGCTGGATAAGCCGGTAA
CGGAGCTGTGTCTCACCTGCATTTGTGAGGCCATTAGTGGTTGCAATGCC
ACGGCGATTTGCACCAGTGCGGAAAAGGGAGCATGCGGCATATTCCGCAT
CACCTGGGGATACTGGGTGGATGCTGGCAAACTGACGGTAAATGGAGAGC
ATCCCGATTCGGAAAAGGCTTTCATCAACTGCGCCAAGGATCCGCACTGT
GCCGCCGATTTGGTGCAAAACTATATGAAGAAGTTCAATCAGGATTGCAA
TGATGATGGTGAGATGGATTGCCACGATTATGCTCGAATCCATAAACTGG
GGGCTTATGGCTGCCAAGCGGACATGCCCTACAATTTCCAGAGTGTGTTC
GAGGAGTGCATCGAGAGGTACGAGGATGAGGGATTTGAGTAAATAAAAAA
TAAACATTATATATATATGTTAATAAACTTAATATTTTTATTTACCCGGG
AAAAAAAAAAAAAAAA

FI09201.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:01:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG6421-RA 842 CG6421-RA 214..814 2..602 3005 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:52:44
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 12759600..12760072 125..600 2180 97.7 Plus
chr2R 21145070 chr2R 12759420..12759546 2..128 635 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:21:29 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:52:43
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16872431..16872908 125..602 2390 100 Plus
2R 25286936 2R 16872251..16872377 2..128 635 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:20:32
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 16873630..16874107 125..602 2390 100 Plus
2R 25260384 2R 16873450..16873576 2..128 635 100 Plus
2R 25260384 2R 16875522..16875581 224..283 165 85 Plus
2R 25260384 2R 16874587..16874676 318..407 150 77.7 Plus
Blast to na_te.dros performed 2019-03-16 17:52:43
Subject Length Description Subject Range Query Range Score Percent Strand
Max-element 8556 Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). 1278..1320 55..97 116 74.4 Plus

FI09201.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:53:39 Download gff for FI09201.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 12759419..12759544 1..126 99 -> Plus
chr2R 12759602..12760009 127..534 98 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:59:34 Download gff for FI09201.complete
Subject Subject Range Query Range Percent Splice Strand
CG6421-RA 1..486 57..542 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:02:31 Download gff for FI09201.complete
Subject Subject Range Query Range Percent Splice Strand
CG6421-RA 1..486 57..542 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:40:44 Download gff for FI09201.complete
Subject Subject Range Query Range Percent Splice Strand
CG6421-RA 1..486 57..542 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:51:32 Download gff for FI09201.complete
Subject Subject Range Query Range Percent Splice Strand
CG6421-RA 1..486 57..542 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:21:13 Download gff for FI09201.complete
Subject Subject Range Query Range Percent Splice Strand
CG6421-RA 1..486 57..542 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:21:39 Download gff for FI09201.complete
Subject Subject Range Query Range Percent Splice Strand
CG6421-RA 2..600 2..600 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:02:31 Download gff for FI09201.complete
Subject Subject Range Query Range Percent Splice Strand
CG6421-RA 2..600 2..600 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:40:44 Download gff for FI09201.complete
Subject Subject Range Query Range Percent Splice Strand
CG6421-RA 2..600 2..600 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-25 13:46:29 Download gff for FI09201.complete
Subject Subject Range Query Range Percent Splice Strand
CG6421-RA 2..600 2..600 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:21:13 Download gff for FI09201.complete
Subject Subject Range Query Range Percent Splice Strand
CG6421-RA 2..600 2..600 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:53:39 Download gff for FI09201.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16872250..16872375 1..126 99 -> Plus
2R 16872433..16872906 127..600 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:53:39 Download gff for FI09201.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16872250..16872375 1..126 99 -> Plus
2R 16872433..16872906 127..600 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:53:39 Download gff for FI09201.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16872250..16872375 1..126 99 -> Plus
2R 16872433..16872906 127..600 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:40:44 Download gff for FI09201.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12759755..12759880 1..126 99 -> Plus
arm_2R 12759938..12760411 127..600 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:30:18 Download gff for FI09201.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16873632..16874105 127..600 100   Plus
2R 16873449..16873574 1..126 99 -> Plus

FI09201.hyp Sequence

Translation from 2 to 541

> FI09201.hyp
FAVSGAEELDVITLTSRKMRVFLLYSIYLLLVLSPSLVQGQGHVLDKPVT
ELCLTCICEAISGCNATAICTSAEKGACGIFRITWGYWVDAGKLTVNGEH
PDSEKAFINCAKDPHCAADLVQNYMKKFNQDCNDDGEMDCHDYARIHKLG
AYGCQADMPYNFQSVFEECIERYEDEGFE*

FI09201.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:44:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG6421-PA 161 CG6421-PA 1..161 19..179 893 100 Plus
CG6429-PA 159 CG6429-PA 24..146 45..170 454 57.1 Plus
CG6426-PA 161 CG6426-PA 15..153 29..174 448 52.7 Plus
CG6435-PA 163 CG6435-PA 4..147 23..174 424 53.3 Plus
CG14823-PA 263 CG14823-PA 138..258 53..171 168 32.5 Plus

FI09201.pep Sequence

Translation from 2 to 541

> FI09201.pep
FAVSGAEELDVITLTSRKMRVFLLYSIYLLLVLSPSLVQGQGHVLDKPVT
ELCLTCICEAISGCNATAICTSAEKGACGIFRITWGYWVDAGKLTVNGEH
PDSEKAFINCAKDPHCAADLVQNYMKKFNQDCNDDGEMDCHDYARIHKLG
AYGCQADMPYNFQSVFEECIERYEDEGFE*

FI09201.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:40:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11418-PA 161 GF11418-PA 1..148 19..166 682 82.4 Plus
Dana\GF11417-PA 161 GF11417-PA 15..153 29..174 436 53.4 Plus
Dana\GF11419-PA 158 GF11419-PA 1..145 24..171 428 52.7 Plus
Dana\GF11420-PA 166 GF11420-PA 8..155 24..179 410 50.6 Plus
Dana\GF25005-PA 264 GF25005-PA 140..253 47..164 153 31.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:40:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20639-PA 161 GG20639-PA 1..161 19..179 800 90.1 Plus
Dere\GG20641-PA 159 GG20641-PA 7..147 27..171 440 52.4 Plus
Dere\GG20638-PA 161 GG20638-PA 15..153 29..174 433 52.7 Plus
Dere\GG20642-PA 163 GG20642-PA 20..144 44..171 401 57.8 Plus
Dere\GG14400-PA 264 GG14400-PA 139..259 53..171 159 31 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:40:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22645-PA 163 GH22645-PA 20..160 38..178 650 80.1 Plus
Dgri\GH22644-PA 161 GH22644-PA 1..153 14..174 450 52.8 Plus
Dgri\GH22647-PA 157 GH22647-PA 9..147 35..176 404 50.7 Plus
Dgri\GH22646-PA 117 GH22646-PA 1..112 57..171 395 60 Plus
Dgri\GH15386-PA 226 GH15386-PA 108..224 48..174 150 31.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:40:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG6421-PA 161 CG6421-PA 1..161 19..179 893 100 Plus
CG6429-PA 159 CG6429-PA 24..146 45..170 454 57.1 Plus
CG6426-PA 161 CG6426-PA 15..153 29..174 448 52.7 Plus
CG6435-PA 163 CG6435-PA 4..147 23..174 424 53.3 Plus
CG14823-PA 263 CG14823-PA 138..258 53..171 168 32.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:40:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21157-PA 190 GI21157-PA 39..182 36..179 616 75.7 Plus
Dmoj\GI21158-PA 158 GI21158-PA 18..149 38..172 453 57 Plus
Dmoj\GI21159-PA 145 GI21159-PA 10..138 44..179 381 54.4 Plus
Dmoj\GI12991-PA 230 GI12991-PA 114..230 53..176 161 30.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:40:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11565-PA 161 GL11565-PA 1..161 19..179 745 82.6 Plus
Dper\GL11566-PA 156 GL11566-PA 8..143 29..170 458 57 Plus
Dper\GL11564-PA 161 GL11564-PA 1..153 14..174 447 50.9 Plus
Dper\GL11567-PA 132 GL11567-PA 1..113 61..176 328 52.6 Plus
Dper\GL25021-PA 254 GL25021-PA 135..235 53..159 173 37.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:40:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19580-PA 161 GA19580-PA 1..161 19..179 745 82.6 Plus
Dpse\GA19586-PA 156 GA19586-PA 4..143 25..170 460 56.2 Plus
Dpse\GA19584-PA 161 GA19584-PA 1..153 14..174 447 50.9 Plus
Dpse\GA19591-PA 132 GA19591-PA 1..113 61..176 333 52.6 Plus
Dpse\GA13274-PA 254 GA13274-PA 135..235 53..159 168 36.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:40:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21732-PA 91 GM21732-PA 1..85 19..103 445 97.6 Plus
Dsec\GM21734-PA 159 GM21734-PA 1..147 24..171 436 52.3 Plus
Dsec\GM21731-PA 161 GM21731-PA 15..153 29..174 433 52.7 Plus
Dsec\GM21736-PA 163 GM21736-PA 20..147 44..174 408 58 Plus
Dsec\GM21733-PA 55 GM21733-PA 1..55 125..179 288 94.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:40:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11227-PA 161 GD11227-PA 1..161 19..179 847 96.3 Plus
Dsim\GD11229-PA 159 GD11229-PA 7..147 27..171 432 51.7 Plus
Dsim\GD11230-PA 163 GD11230-PA 20..147 44..174 408 58 Plus
Dsim\GD13989-PA 263 GD13989-PA 138..258 53..171 164 31.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:40:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21010-PA 161 GJ21010-PA 20..161 38..179 649 80.3 Plus
Dvir\GJ21009-PA 161 GJ21009-PA 23..153 37..174 455 58 Plus
Dvir\GJ21011-PA 162 GJ21011-PA 27..151 47..174 435 56.2 Plus
Dvir\GJ21007-PA 145 GJ21007-PA 8..139 37..175 421 55.4 Plus
Dvir\GJ21008-PA 161 GJ21008-PA 1..154 14..175 421 48.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:40:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22026-PA 166 GK22026-PA 1..161 19..178 716 78.3 Plus
Dwil\GK22025-PA 161 GK22025-PA 1..153 14..174 438 50.3 Plus
Dwil\GK22027-PA 163 GK22027-PA 6..156 27..176 416 50.6 Plus
Dwil\GK22028-PA 172 GK22028-PA 13..161 23..176 395 50 Plus
Dwil\GK16648-PA 274 GK16648-PA 161..270 53..171 160 33.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:40:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11828-PA 159 GE11828-PA 1..159 19..179 819 93.8 Plus
Dyak\GE11829-PA 159 GE11829-PA 7..147 27..171 437 52.4 Plus
Dyak\GE11827-PA 161 GE11827-PA 15..153 29..174 432 52.7 Plus
Dyak\GE11830-PA 164 GE11830-PA 20..147 44..174 408 58 Plus
Dyak\GE21589-PA 262 GE21589-PA 137..243 53..159 154 33 Plus