FI09213.complete Sequence
509 bp assembled on 2008-07-25
GenBank Submission: BT032674
> FI09213.complete
AGTTCAGTGGTGCAACTTATAAACAGCGTTTTGTGTTTCGCAAAATAATA
TACAATTTTCAGTCAGTAAGTAAACGAGAAGTGCAAATACTTTTATTAAA
TGGCCGACGAAACAGAGCAGCTCAGTCAGGTGATTTTGCCGGTAAAGGAG
CCTTTGGATCTCATCCGATTGAGTTTAGATGAGAAGGTGTACGTAAAGAT
GCGCAACGAGCGGGAACTGCGAGGACGTCTTCACGCCTTTGATCAACATT
TGAACATGGTGCTCGGCGATGCGGAGGAGACGGTGACCACTGTGGAGATC
GACGAGGAGACCTATGAGGAGGTGTACAAGACCGCCAAGCGCACTATTCC
CATGCTATTCGTTAGAGGCGATGGAGTCATCCTGGTTTCGCCACCCATGC
GGGTGGGCTAGCGGGTCTTGTTTAGCTTTAAATCAATTACCTGCATTTAT
ACAAGCTATATCTAAATAGGTTTATAAATGTCTTTTAAAAAATAAAAAAA
AAAAAAAAA
FI09213.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:01:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
LSm3-RB | 570 | LSm3-RB | 4..495 | 1..492 | 2445 | 99.7 | Plus |
LSm3-RA | 724 | LSm3-RA | 158..649 | 1..492 | 2445 | 99.7 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:56:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 19820163..19820420 | 235..492 | 1275 | 99.6 | Plus |
chr3R | 27901430 | chr3R | 19819816..19819935 | 1..120 | 600 | 100 | Plus |
chr3R | 27901430 | chr3R | 19819985..19820103 | 117..235 | 595 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:21:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:56:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 23996766..23997023 | 235..492 | 1275 | 99.6 | Plus |
3R | 32079331 | 3R | 23996419..23996538 | 1..120 | 600 | 100 | Plus |
3R | 32079331 | 3R | 23996588..23996706 | 117..235 | 595 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:20:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 23737597..23737854 | 235..492 | 1275 | 99.6 | Plus |
3R | 31820162 | 3R | 23737250..23737369 | 1..120 | 600 | 100 | Plus |
3R | 31820162 | 3R | 23737419..23737537 | 117..235 | 595 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-15 20:56:38 has no hits.
FI09213.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:57:52 Download gff for
FI09213.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 19819816..19819935 | 1..120 | 100 | -> | Plus |
chr3R | 19819989..19820102 | 121..234 | 100 | -> | Plus |
chr3R | 19820163..19820420 | 235..493 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:59:39 Download gff for
FI09213.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31184-RA | 1..312 | 100..411 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:02:36 Download gff for
FI09213.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
LSm3-RB | 1..312 | 100..411 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:32:01 Download gff for
FI09213.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
LSm3-RA | 1..312 | 100..411 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:51:21 Download gff for
FI09213.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31184-RA | 1..312 | 100..411 | 99 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:38:15 Download gff for
FI09213.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
LSm3-RA | 1..312 | 100..411 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:21:51 Download gff for
FI09213.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31184-RA | 158..649 | 1..493 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:02:36 Download gff for
FI09213.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
LSm3-RA | 158..649 | 1..493 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:32:01 Download gff for
FI09213.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
LSm3-RA | 158..643 | 1..486 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-25 13:46:20 Download gff for
FI09213.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31184-RA | 158..649 | 1..493 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:38:15 Download gff for
FI09213.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
LSm3-RA | 158..643 | 1..486 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:57:52 Download gff for
FI09213.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 23996419..23996538 | 1..120 | 100 | -> | Plus |
3R | 23996592..23996705 | 121..234 | 100 | -> | Plus |
3R | 23996766..23997023 | 235..493 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:57:52 Download gff for
FI09213.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 23996419..23996538 | 1..120 | 100 | -> | Plus |
3R | 23996592..23996705 | 121..234 | 100 | -> | Plus |
3R | 23996766..23997023 | 235..493 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:57:52 Download gff for
FI09213.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 23996419..23996538 | 1..120 | 100 | -> | Plus |
3R | 23996592..23996705 | 121..234 | 100 | -> | Plus |
3R | 23996766..23997023 | 235..493 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:32:01 Download gff for
FI09213.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 19822141..19822260 | 1..120 | 100 | -> | Plus |
arm_3R | 19822314..19822427 | 121..234 | 100 | -> | Plus |
arm_3R | 19822488..19822745 | 235..493 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:30:24 Download gff for
FI09213.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 23737597..23737854 | 235..493 | 99 | | Plus |
3R | 23737250..23737369 | 1..120 | 100 | -> | Plus |
3R | 23737423..23737536 | 121..234 | 100 | -> | Plus |
FI09213.pep Sequence
Translation from 99 to 410
> FI09213.pep
MADETEQLSQVILPVKEPLDLIRLSLDEKVYVKMRNERELRGRLHAFDQH
LNMVLGDAEETVTTVEIDEETYEEVYKTAKRTIPMLFVRGDGVILVSPPM
RVG*
FI09213.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:41:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF17032-PA | 301 | GF17032-PA | 160..194 | 11..45 | 178 | 100 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:41:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG11245-PA | 176 | GG11245-PA | 1..101 | 1..101 | 513 | 99 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:00:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
LSm3-PB | 103 | CG31184-PB | 1..103 | 1..103 | 517 | 100 | Plus |
LSm3-PA | 103 | CG31184-PA | 1..103 | 1..103 | 517 | 100 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:41:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL23390-PA | 103 | GL23390-PA | 1..103 | 1..103 | 509 | 97.1 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:41:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA29226-PA | 103 | GA29226-PA | 1..103 | 1..103 | 509 | 97.1 | Plus |
Dpse\GA29224-PA | 167 | GA29224-PA | 74..167 | 10..103 | 483 | 98.9 | Plus |
Dpse\GA30187-PA | 100 | GA30187-PA | 1..100 | 1..103 | 480 | 94.2 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:41:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD21053-PA | 218 | GD21053-PA | 1..102 | 1..102 | 519 | 99 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:41:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK14178-PA | 256 | GK14178-PA | 161..256 | 8..103 | 491 | 99 | Plus |
FI09213.hyp Sequence
Translation from 99 to 410
> FI09213.hyp
MADETEQLSQVILPVKEPLDLIRLSLDEKVYVKMRNERELRGRLHAFDQH
LNMVLGDAEETVTTVEIDEETYEEVYKTAKRTIPMLFVRGDGVILVSPPM
RVG*
FI09213.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:44:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
LSm3-PB | 103 | CG31184-PB | 1..103 | 1..103 | 517 | 100 | Plus |
LSm3-PA | 103 | CG31184-PA | 1..103 | 1..103 | 517 | 100 | Plus |