Clone FI09213 Report

Search the DGRC for FI09213

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:92
Well:13
Vector:pFlc-1
Associated Gene/TranscriptLSm3-RA
Protein status:FI09213.pep: gold
Sequenced Size:509

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31184 2008-08-15 Release 5.9 accounting
CG31184 2008-12-18 5.12 accounting

Clone Sequence Records

FI09213.complete Sequence

509 bp assembled on 2008-07-25

GenBank Submission: BT032674

> FI09213.complete
AGTTCAGTGGTGCAACTTATAAACAGCGTTTTGTGTTTCGCAAAATAATA
TACAATTTTCAGTCAGTAAGTAAACGAGAAGTGCAAATACTTTTATTAAA
TGGCCGACGAAACAGAGCAGCTCAGTCAGGTGATTTTGCCGGTAAAGGAG
CCTTTGGATCTCATCCGATTGAGTTTAGATGAGAAGGTGTACGTAAAGAT
GCGCAACGAGCGGGAACTGCGAGGACGTCTTCACGCCTTTGATCAACATT
TGAACATGGTGCTCGGCGATGCGGAGGAGACGGTGACCACTGTGGAGATC
GACGAGGAGACCTATGAGGAGGTGTACAAGACCGCCAAGCGCACTATTCC
CATGCTATTCGTTAGAGGCGATGGAGTCATCCTGGTTTCGCCACCCATGC
GGGTGGGCTAGCGGGTCTTGTTTAGCTTTAAATCAATTACCTGCATTTAT
ACAAGCTATATCTAAATAGGTTTATAAATGTCTTTTAAAAAATAAAAAAA
AAAAAAAAA

FI09213.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:01:59
Subject Length Description Subject Range Query Range Score Percent Strand
LSm3-RB 570 LSm3-RB 4..495 1..492 2445 99.7 Plus
LSm3-RA 724 LSm3-RA 158..649 1..492 2445 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:56:39
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 19820163..19820420 235..492 1275 99.6 Plus
chr3R 27901430 chr3R 19819816..19819935 1..120 600 100 Plus
chr3R 27901430 chr3R 19819985..19820103 117..235 595 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:21:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:56:37
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23996766..23997023 235..492 1275 99.6 Plus
3R 32079331 3R 23996419..23996538 1..120 600 100 Plus
3R 32079331 3R 23996588..23996706 117..235 595 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:20:35
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 23737597..23737854 235..492 1275 99.6 Plus
3R 31820162 3R 23737250..23737369 1..120 600 100 Plus
3R 31820162 3R 23737419..23737537 117..235 595 100 Plus
Blast to na_te.dros performed on 2019-03-15 20:56:38 has no hits.

FI09213.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:57:52 Download gff for FI09213.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 19819816..19819935 1..120 100 -> Plus
chr3R 19819989..19820102 121..234 100 -> Plus
chr3R 19820163..19820420 235..493 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:59:39 Download gff for FI09213.complete
Subject Subject Range Query Range Percent Splice Strand
CG31184-RA 1..312 100..411 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:02:36 Download gff for FI09213.complete
Subject Subject Range Query Range Percent Splice Strand
LSm3-RB 1..312 100..411 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:32:01 Download gff for FI09213.complete
Subject Subject Range Query Range Percent Splice Strand
LSm3-RA 1..312 100..411 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:51:21 Download gff for FI09213.complete
Subject Subject Range Query Range Percent Splice Strand
CG31184-RA 1..312 100..411 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:38:15 Download gff for FI09213.complete
Subject Subject Range Query Range Percent Splice Strand
LSm3-RA 1..312 100..411 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:21:51 Download gff for FI09213.complete
Subject Subject Range Query Range Percent Splice Strand
CG31184-RA 158..649 1..493 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:02:36 Download gff for FI09213.complete
Subject Subject Range Query Range Percent Splice Strand
LSm3-RA 158..649 1..493 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:32:01 Download gff for FI09213.complete
Subject Subject Range Query Range Percent Splice Strand
LSm3-RA 158..643 1..486 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-25 13:46:20 Download gff for FI09213.complete
Subject Subject Range Query Range Percent Splice Strand
CG31184-RA 158..649 1..493 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:38:15 Download gff for FI09213.complete
Subject Subject Range Query Range Percent Splice Strand
LSm3-RA 158..643 1..486 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:57:52 Download gff for FI09213.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23996419..23996538 1..120 100 -> Plus
3R 23996592..23996705 121..234 100 -> Plus
3R 23996766..23997023 235..493 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:57:52 Download gff for FI09213.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23996419..23996538 1..120 100 -> Plus
3R 23996592..23996705 121..234 100 -> Plus
3R 23996766..23997023 235..493 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:57:52 Download gff for FI09213.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23996419..23996538 1..120 100 -> Plus
3R 23996592..23996705 121..234 100 -> Plus
3R 23996766..23997023 235..493 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:32:01 Download gff for FI09213.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19822141..19822260 1..120 100 -> Plus
arm_3R 19822314..19822427 121..234 100 -> Plus
arm_3R 19822488..19822745 235..493 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:30:24 Download gff for FI09213.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23737597..23737854 235..493 99   Plus
3R 23737250..23737369 1..120 100 -> Plus
3R 23737423..23737536 121..234 100 -> Plus

FI09213.pep Sequence

Translation from 99 to 410

> FI09213.pep
MADETEQLSQVILPVKEPLDLIRLSLDEKVYVKMRNERELRGRLHAFDQH
LNMVLGDAEETVTTVEIDEETYEEVYKTAKRTIPMLFVRGDGVILVSPPM
RVG*

FI09213.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:41:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17032-PA 301 GF17032-PA 160..194 11..45 178 100 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:41:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11245-PA 176 GG11245-PA 1..101 1..101 513 99 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:00:36
Subject Length Description Subject Range Query Range Score Percent Strand
LSm3-PB 103 CG31184-PB 1..103 1..103 517 100 Plus
LSm3-PA 103 CG31184-PA 1..103 1..103 517 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:41:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23390-PA 103 GL23390-PA 1..103 1..103 509 97.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:41:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA29226-PA 103 GA29226-PA 1..103 1..103 509 97.1 Plus
Dpse\GA29224-PA 167 GA29224-PA 74..167 10..103 483 98.9 Plus
Dpse\GA30187-PA 100 GA30187-PA 1..100 1..103 480 94.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:41:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21053-PA 218 GD21053-PA 1..102 1..102 519 99 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:41:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14178-PA 256 GK14178-PA 161..256 8..103 491 99 Plus

FI09213.hyp Sequence

Translation from 99 to 410

> FI09213.hyp
MADETEQLSQVILPVKEPLDLIRLSLDEKVYVKMRNERELRGRLHAFDQH
LNMVLGDAEETVTTVEIDEETYEEVYKTAKRTIPMLFVRGDGVILVSPPM
RVG*

FI09213.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:44:38
Subject Length Description Subject Range Query Range Score Percent Strand
LSm3-PB 103 CG31184-PB 1..103 1..103 517 100 Plus
LSm3-PA 103 CG31184-PA 1..103 1..103 517 100 Plus