Clone FI09226 Report

Search the DGRC for FI09226

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:92
Well:26
Vector:pFlc-1
Associated Gene/TranscriptAnxB9-RC
Protein status:FI09226.pep: gold
Sequenced Size:1447

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
AnnIX 2008-12-18 5.12 accounting

Clone Sequence Records

FI09226.complete Sequence

1447 bp assembled on 2008-09-12

GenBank Submission: BT044420.1

> FI09226.complete
GATGGTATTTATTCACATCGCTTGCAGTTCGCATCGTCTGACTTATTTTT
CACAACAAACCAATCAAAATGAGTTCCGCTGAGTACTACCCATTCAAGTG
CACACCCACTGTCTACCCGGCGGATCCCTTCGATCCCGTCGAGGATGCGG
CTATTCTGCGCAAGGCGATGAAAGGCTTCGGCACCGACGAGAAGGCCATC
ATCGAGATCCTGGCCAGGCGTGGCATCGTCCAGCGTTTGGAGATCGCTGA
GGCGTTCAAGACCTCGTACGGCAAGGACCTGATCTCGGACCTCAAGTCCG
AACTGGGCGGCAAATTCGAGGATGTTATCCTGGCTCTGATGACGCCGCTG
CCCCAGTTCTATGCCCAGGAGCTGCACGACGCCATCTCGGGACTGGGAAC
CGACGAGGAGGCCATCATCGAGATCCTCTGCACGCTGTCCAACTACGGCA
TCAAGACCATTGCCCAGTTCTACGAGCAGAGCTTCGGCAAGTCCCTAGAG
TCCGACCTGAAGGGCGACACCAGTGGCCACTTCAAGCGGCTGTGTGTCTC
GCTCGTCCAGGGCAACCGGGATGAGAACCAGGGCGTGGACGAGGCCGCGG
CCATCGCCGATGCCCAGGCTCTGCACGACGCCGGCGAGGGACAGTGGGGC
ACAGATGAGTCCACCTTCAACTCGATCCTGATCACCCGCTCCTACCAGCA
GCTGCGCCAGATCTTCCTCGAATACGAGAATCTGTCGGGCAACGACATCG
AGAAGGCCATCAAGCGGGAGTTTAGCGGCTCCGTGGAGAAGGGTTTCCTG
GCCATCGTCAAGTGCTGCAAGTCCAAGATCGACTACTTTTCGGAGCGCCT
GCACGACTCAATGGCCGGCATGGGCACCAAGGACAAGACGCTGATCCGCA
TCATTGTCAGCCGGTCGGAGATCGATCTGGGTGACATCAAGGAGGCATTC
CAGAACAAGTACGGCAAGAGCTTGGAGTCCTGGATCAAGGGCGATACATC
CGGCGATTATAAGCGTGCCCTATTGGCTATTGTTGGCTTCTAAAAAGAAC
CCCATCCAACAATAATTTATCTCTTTCGTCTGTTCCACGCTCTAAACTAT
ATGCAAACAGAATGTACAAACAAAATTCCGATATCAAATAGTTGACAATG
TATAGTTTTTGAATTGGAACACGTTTTAACGAAGACGCAGTGCATTTAAG
TCGTAGAATCAGAACCCCAGTCTCGCATCCTGTTGATTATTATAACCATT
GTGACTTTTATTATTATGACTATGCACGCCACATGCACATAATTGTATCT
CTATAATTACTACACCTCAGGCTACTTGCATTGCTGTGTAGGTATACTTT
CAGTTTTGTTTTGAGTCTCATTTGCAAGATATTTTAACTTTTAAAAAATA
CGAAAATAAAAAATACGAAAAAATGAAATACAAAAAAAAAAAAAAAA

FI09226.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:00:45
Subject Length Description Subject Range Query Range Score Percent Strand
AnnIX-RC 1684 AnnIX-RC 102..1535 2..1435 7170 100 Plus
AnnIX.g 1491 AnnIX.g 95..1485 45..1435 6955 100 Plus
AnnIX.f 1582 AnnIX.f 186..1576 45..1435 6955 100 Plus
AnnIX.g 1491 AnnIX.g 27..69 2..44 215 100 Plus
AnnIX.f 1582 AnnIX.f 27..69 2..44 215 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:51:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 16891939..16892649 97..807 3435 98.9 Plus
chr3R 27901430 chr3R 16893183..16893626 988..1431 2220 100 Plus
chr3R 27901430 chr3R 16892709..16892892 807..990 875 98.4 Plus
chr3R 27901430 chr3R 16891315..16891368 45..98 270 100 Plus
chrX 22417052 chrX 16308433..16308507 443..369 225 86.7 Minus
chr3R 27901430 chr3R 16889114..16889153 5..44 200 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:21:40 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:51:54
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21068067..21068777 97..807 3555 100 Plus
3R 32079331 3R 21069311..21069758 988..1435 2240 100 Plus
3R 32079331 3R 21068837..21069020 807..990 920 100 Plus
3R 32079331 3R 21067446..21067499 45..98 270 100 Plus
X 23542271 X 16418705..16418779 443..369 225 86.7 Minus
3R 32079331 3R 21065243..21065285 2..44 215 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:19:26
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 20808898..20809608 97..807 3555 100 Plus
3R 31820162 3R 20810142..20810589 988..1435 2240 100 Plus
3R 31820162 3R 20809668..20809851 807..990 920 100 Plus
3R 31820162 3R 20808277..20808330 45..98 270 100 Plus
X 23527363 X 16426803..16426877 443..369 225 86.6 Minus
3R 31820162 3R 20806074..20806116 2..44 215 100 Plus
Blast to na_te.dros performed on 2019-03-15 14:51:54 has no hits.

FI09226.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:52:35 Download gff for FI09226.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 16892710..16892891 808..989 98 -> Plus
chr3R 16889110..16889153 1..44 95 -> Plus
chr3R 16891315..16891368 45..98 100 -> Plus
chr3R 16891941..16892649 99..807 98 -> Plus
chr3R 16893185..16893626 990..1431 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:59:48 Download gff for FI09226.complete
Subject Subject Range Query Range Percent Splice Strand
AnnIX-RC 1..975 69..1043 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:00:47 Download gff for FI09226.complete
Subject Subject Range Query Range Percent Splice Strand
AnnIX-RC 1..975 69..1043 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:47:00 Download gff for FI09226.complete
Subject Subject Range Query Range Percent Splice Strand
AnxB9-RC 1..975 69..1043 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:12:51 Download gff for FI09226.complete
Subject Subject Range Query Range Percent Splice Strand
AnxB9-RC 1..975 69..1043 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:18:54 Download gff for FI09226.complete
Subject Subject Range Query Range Percent Splice Strand
AnnIX-RC 14..1444 1..1431 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:00:47 Download gff for FI09226.complete
Subject Subject Range Query Range Percent Splice Strand
AnnIX-RC 14..1444 1..1431 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:47:00 Download gff for FI09226.complete
Subject Subject Range Query Range Percent Splice Strand
AnxB9-RC 2..1432 1..1431 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-12 15:54:26 Download gff for FI09226.complete
Subject Subject Range Query Range Percent Splice Strand
AnnIX-RC 14..1444 1..1431 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:12:51 Download gff for FI09226.complete
Subject Subject Range Query Range Percent Splice Strand
AnxB9-RC 2..1432 1..1431 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:52:35 Download gff for FI09226.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21065242..21065285 1..44 97 -> Plus
3R 21067446..21067499 45..98 100 -> Plus
3R 21068069..21068777 99..807 100 -> Plus
3R 21068838..21069019 808..989 100 -> Plus
3R 21069313..21069754 990..1431 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:52:35 Download gff for FI09226.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21065242..21065285 1..44 97 -> Plus
3R 21067446..21067499 45..98 100 -> Plus
3R 21068069..21068777 99..807 100 -> Plus
3R 21068838..21069019 808..989 100 -> Plus
3R 21069313..21069754 990..1431 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:52:35 Download gff for FI09226.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21065242..21065285 1..44 97 -> Plus
3R 21067446..21067499 45..98 100 -> Plus
3R 21068069..21068777 99..807 100 -> Plus
3R 21068838..21069019 808..989 100 -> Plus
3R 21069313..21069754 990..1431 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:47:00 Download gff for FI09226.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 16890964..16891007 1..44 97 -> Plus
arm_3R 16893168..16893221 45..98 100 -> Plus
arm_3R 16893791..16894499 99..807 100 -> Plus
arm_3R 16894560..16894741 808..989 100 -> Plus
arm_3R 16895035..16895476 990..1431 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:27:55 Download gff for FI09226.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20808900..20809608 99..807 100 -> Plus
3R 20809669..20809850 808..989 100 -> Plus
3R 20810144..20810585 990..1431 100   Plus
3R 20806073..20806116 1..44 97 -> Plus
3R 20808277..20808330 45..98 100 -> Plus

FI09226.pep Sequence

Translation from 68 to 1042

> FI09226.pep
MSSAEYYPFKCTPTVYPADPFDPVEDAAILRKAMKGFGTDEKAIIEILAR
RGIVQRLEIAEAFKTSYGKDLISDLKSELGGKFEDVILALMTPLPQFYAQ
ELHDAISGLGTDEEAIIEILCTLSNYGIKTIAQFYEQSFGKSLESDLKGD
TSGHFKRLCVSLVQGNRDENQGVDEAAAIADAQALHDAGEGQWGTDESTF
NSILITRSYQQLRQIFLEYENLSGNDIEKAIKREFSGSVEKGFLAIVKCC
KSKIDYFSERLHDSMAGMGTKDKTLIRIIVSRSEIDLGDIKEAFQNKYGK
SLESWIKGDTSGDYKRALLAIVGF*

FI09226.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:54:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16493-PA 341 GF16493-PA 1..324 1..324 1680 98.1 Plus
Dana\GF19282-PA 356 GF19282-PA 40..351 12..323 952 59 Plus
Dana\GF20448-PA 321 GF20448-PA 4..319 9..323 715 48.1 Plus
Dana\GF19282-PA 356 GF19282-PA 201..354 18..167 178 31.8 Plus
Dana\GF20448-PA 321 GF20448-PA 168..320 17..165 162 27.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:54:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24321-PA 341 GG24321-PA 1..324 1..324 1711 100 Plus
Dere\GG19323-PA 505 GG19323-PA 189..500 12..323 935 58.7 Plus
Dere\GG18007-PA 320 GG18007-PA 3..318 9..323 743 46.5 Plus
Dere\GG19323-PA 505 GG19323-PA 371..503 38..167 178 33.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 11:54:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17323-PA 324 GH17323-PA 1..324 1..324 1667 97.2 Plus
Dgri\GH12030-PA 492 GH12030-PA 176..487 12..323 937 57.7 Plus
Dgri\GH12087-PA 320 GH12087-PA 3..310 9..315 705 46.1 Plus
Dgri\GH12030-PA 492 GH12030-PA 337..490 18..167 182 33.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:49:05
Subject Length Description Subject Range Query Range Score Percent Strand
AnxB9-PF 324 CG5730-PF 1..324 1..324 1654 100 Plus
AnxB9-PE 324 CG5730-PE 1..324 1..324 1654 100 Plus
AnxB9-PC 324 CG5730-PC 1..324 1..324 1654 100 Plus
AnxB9-PB 324 CG5730-PB 1..324 1..324 1600 96.6 Plus
AnxB9-PD 324 CG5730-PD 1..324 1..324 1600 96.6 Plus
AnxB9-PA 324 CG5730-PA 1..324 1..324 1579 95.7 Plus
AnxB11-PF 322 CG9968-PF 2..317 7..323 918 58.7 Plus
AnxB11-PC 322 CG9968-PC 2..317 7..323 918 58.7 Plus
AnxB11-PA 322 CG9968-PA 2..317 7..323 918 58.7 Plus
AnxB11-PG 511 CG9968-PG 195..506 12..323 912 58.7 Plus
AnxB11-PE 511 CG9968-PE 195..506 12..323 912 58.7 Plus
AnxB11-PB 511 CG9968-PB 195..506 12..323 912 58.7 Plus
AnxB11-PD 295 CG9968-PD 1..290 34..323 846 57.9 Plus
AnxB10-PA 320 CG9579-PA 3..318 9..323 720 47.2 Plus
AnxB10-PB 321 CG9579-PB 3..319 9..323 709 47 Plus
AnxB11-PF 322 CG9968-PF 168..320 19..167 197 33.3 Plus
AnxB11-PC 322 CG9968-PC 168..320 19..167 197 33.3 Plus
AnxB11-PA 322 CG9968-PA 168..320 19..167 197 33.3 Plus
AnxB11-PG 511 CG9968-PG 357..509 19..167 197 33.3 Plus
AnxB11-PE 511 CG9968-PE 357..509 19..167 197 33.3 Plus
AnxB11-PB 511 CG9968-PB 357..509 19..167 197 33.3 Plus
AnxB11-PD 295 CG9968-PD 141..293 19..167 197 33.3 Plus
AnxB11-PD 295 CG9968-PD 60..289 23..247 196 29.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 11:54:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22446-PA 324 GI22446-PA 1..324 1..324 1596 95.7 Plus
Dmoj\GI14303-PA 505 GI14303-PA 189..500 12..323 944 58.3 Plus
Dmoj\GI11094-PA 320 GI11094-PA 3..318 9..323 752 46.8 Plus
Dmoj\GI14303-PA 505 GI14303-PA 351..503 19..167 184 32.7 Plus
Dmoj\GI11094-PA 320 GI11094-PA 188..319 37..165 152 26.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:54:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11940-PA 324 GL11940-PA 1..324 1..324 1702 99.1 Plus
Dper\GL15887-PA 512 GL15887-PA 196..507 12..323 923 56.7 Plus
Dper\GL12917-PA 335 GL12917-PA 3..333 9..323 725 45.9 Plus
Dper\GL15887-PA 512 GL15887-PA 358..510 19..167 180 32.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:54:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19090-PA 324 GA19090-PA 1..324 1..324 1702 99.1 Plus
Dpse\GA22156-PA 505 GA22156-PA 189..500 12..323 920 56.7 Plus
Dpse\AnnX-PA 320 GA22806-PA 3..318 9..323 762 48.1 Plus
Dpse\GA22156-PA 505 GA22156-PA 351..503 19..167 181 32.7 Plus
Dpse\AnnX-PA 320 GA22806-PA 167..319 17..165 159 27.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:54:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15061-PA 304 GM15061-PA 1..304 1..324 1398 88.3 Plus
Dsec\GM13401-PA 322 GM13401-PA 2..317 7..323 949 58.7 Plus
Dsec\GM22687-PA 320 GM22687-PA 3..318 9..323 746 47.2 Plus
Dsec\GM13401-PA 322 GM13401-PA 157..320 11..167 188 31.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:54:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19393-PA 341 GD19393-PA 1..324 1..324 1709 100 Plus
Dsim\GD15750-PA 322 GD15750-PA 2..317 7..323 948 58.7 Plus
Dsim\GD22929-PA 320 GD22929-PA 3..318 9..323 753 47.2 Plus
Dsim\GD15750-PA 322 GD15750-PA 157..320 11..167 188 31.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 11:54:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11008-PA 324 GJ11008-PA 1..324 1..324 1680 97.5 Plus
Dvir\GJ19360-PA 505 GJ19360-PA 189..500 12..323 946 58.3 Plus
Dvir\GJ15779-PA 320 GJ15779-PA 3..318 9..323 745 48.1 Plus
Dvir\GJ19360-PA 505 GJ19360-PA 351..503 19..167 181 32.7 Plus
Dvir\GJ15779-PA 320 GJ15779-PA 188..319 37..165 153 27.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:54:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14180-PA 324 GK14180-PA 1..324 1..324 1686 98.1 Plus
Dwil\GK25708-PA 672 GK25708-PA 356..667 12..323 956 59 Plus
Dwil\GK25596-PA 320 GK25596-PA 15..318 21..323 714 47 Plus
Dwil\GK25708-PA 672 GK25708-PA 518..670 19..167 185 32.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:54:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15970-PA 505 GE15970-PA 189..500 12..323 938 59 Plus
Dyak\GE15364-PA 320 GE15364-PA 3..318 9..323 747 47.2 Plus
Dyak\GE15970-PA 505 GE15970-PA 351..503 19..167 185 33.3 Plus

FI09226.hyp Sequence

Translation from 68 to 1042

> FI09226.hyp
MSSAEYYPFKCTPTVYPADPFDPVEDAAILRKAMKGFGTDEKAIIEILAR
RGIVQRLEIAEAFKTSYGKDLISDLKSELGGKFEDVILALMTPLPQFYAQ
ELHDAISGLGTDEEAIIEILCTLSNYGIKTIAQFYEQSFGKSLESDLKGD
TSGHFKRLCVSLVQGNRDENQGVDEAAAIADAQALHDAGEGQWGTDESTF
NSILITRSYQQLRQIFLEYENLSGNDIEKAIKREFSGSVEKGFLAIVKCC
KSKIDYFSERLHDSMAGMGTKDKTLIRIIVSRSEIDLGDIKEAFQNKYGK
SLESWIKGDTSGDYKRALLAIVGF*

FI09226.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:45:09
Subject Length Description Subject Range Query Range Score Percent Strand
AnxB9-PF 324 CG5730-PF 1..324 1..324 1654 100 Plus
AnxB9-PE 324 CG5730-PE 1..324 1..324 1654 100 Plus
AnxB9-PC 324 CG5730-PC 1..324 1..324 1654 100 Plus
AnxB9-PB 324 CG5730-PB 1..324 1..324 1600 96.6 Plus
AnxB9-PD 324 CG5730-PD 1..324 1..324 1600 96.6 Plus