BDGP Sequence Production Resources |
Search the DGRC for FI09234
Library: | FI |
Tissue Source: | various Drosophila melanogaster |
Created by: | |
Date Registered: | 2005-11-08 |
Comments: | Drosophila melanogaster corrected cDNA clones |
Original Plate Number: | 92 |
Well: | 34 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG32817-RA |
Protein status: | FI09234.pep: gold |
Sequenced Size: | 548 |
Gene | Date | Evidence |
---|---|---|
CG32817 | 2008-08-15 | Release 5.9 accounting |
CG32817 | 2008-12-18 | 5.12 accounting |
548 bp assembled on 2008-07-25
GenBank Submission: BT032675
> FI09234.complete GCTTGCAATTTGGAAATTTTAAGGGTTCTGATTGCACTTCTCGCTGACCT CAAACAAATCAAAGAAGACAATCAAAATGCTTTTCGATGGCGCAACCGGC AATGGGCACGGTCAGGGCCAGAATACCCTGAATCCATTGGGGCCAGGCCA GGAGGAGCCCGCCCTATGCGAGCAGTACTATCTGCTGGGCGATGGTTCCA TCATTCTGCGCAACCATTCCATCGACTTGTCGAATCCGCCCCTGAAATCG CGCTGCTGCCAGCTCCCAACACTCATCCACGACATATGCGTCAACTGCGT GATGGATCTCTGCGAGGAGTGTGGCTACTCCTGCGGCGAGTGCGCCAAGT TTATTTGCCGCAACTGCGTGACTTTATTTGGTAATCGAATTGAAGAAGAG GAGGCTCCGCTGTGCGAGCACTGCCAGATGTTCCTCAGCTAGGGCATCAA ACAATCAAGCAAATGTCAAATGTATTACGTTTTAAAGAATATAGAGCTAT ATAGTATTTAACATTAAAAAAAAAAAAAAAAAAGAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG32817.c | 1561 | CG32817.c | 46..567 | 3..524 | 2580 | 99.6 | Plus |
CG32817.b | 1840 | CG32817.b | 325..846 | 3..524 | 2580 | 99.6 | Plus |
CG32817.d | 1568 | CG32817.d | 113..574 | 63..524 | 2280 | 99.5 | Plus |
CG32817.d | 1568 | CG32817.d | 5..64 | 3..62 | 300 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chrX | 22417052 | chrX | 373663..373978 | 63..378 | 1580 | 100 | Plus |
chrX | 22417052 | chrX | 376151..376466 | 63..378 | 1550 | 99.4 | Plus |
chrX | 22417052 | chrX | 371640..371964 | 63..378 | 1110 | 90.2 | Plus |
chrX | 22417052 | chrX | 374063..374208 | 379..524 | 700 | 98.6 | Plus |
chrX | 22417052 | chrX | 376551..376688 | 379..516 | 675 | 99.3 | Plus |
chrX | 22417052 | chrX | 373483..373542 | 3..62 | 300 | 100 | Plus |
chrX | 22417052 | chrX | 375971..376030 | 3..62 | 300 | 100 | Plus |
chrX | 22417052 | chrX | 372046..372128 | 379..461 | 265 | 88 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
X | 23542271 | X | 479630..479945 | 63..378 | 1580 | 100 | Plus |
X | 23542271 | X | 482118..482433 | 63..378 | 1550 | 99.4 | Plus |
X | 23542271 | X | 477607..477931 | 63..378 | 1110 | 90.2 | Plus |
X | 23542271 | X | 480030..480175 | 379..524 | 700 | 98.6 | Plus |
X | 23542271 | X | 482518..482655 | 379..516 | 675 | 99.3 | Plus |
X | 23542271 | X | 479450..479509 | 3..62 | 300 | 100 | Plus |
X | 23542271 | X | 481938..481997 | 3..62 | 300 | 100 | Plus |
X | 23542271 | X | 478013..478095 | 379..461 | 265 | 88 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
X | 23527363 | X | 487728..488043 | 63..378 | 1580 | 100 | Plus |
X | 23527363 | X | 490216..490531 | 63..378 | 1550 | 99.3 | Plus |
X | 23527363 | X | 488128..488273 | 379..524 | 700 | 98.6 | Plus |
X | 23527363 | X | 490616..490753 | 379..516 | 675 | 99.2 | Plus |
X | 23527363 | X | 485705..485886 | 63..244 | 670 | 91.2 | Plus |
X | 23527363 | X | 485894..486029 | 243..378 | 575 | 94.8 | Plus |
X | 23527363 | X | 487548..487607 | 3..62 | 300 | 100 | Plus |
X | 23527363 | X | 490036..490095 | 3..62 | 300 | 100 | Plus |
X | 23527363 | X | 486111..486193 | 379..461 | 265 | 87.9 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chrX | 373479..373542 | 1..62 | 96 | -> | Plus |
chrX | 373663..373978 | 63..378 | 100 | -> | Plus |
chrX | 374063..374199 | 379..515 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32817-RB | 1..366 | 77..442 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32817-RB | 1..366 | 77..442 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32817-RA | 1..366 | 77..442 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32817-RA | 1..366 | 77..442 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32817-RA | 1..366 | 77..442 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32817-RA | 1..517 | 1..515 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32817-RA | 1..517 | 1..515 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32817-RA | 16..532 | 1..515 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32817-RA | 1..517 | 1..515 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32817-RA | 16..532 | 1..515 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 479446..479509 | 1..62 | 96 | -> | Plus |
X | 479630..479945 | 63..378 | 100 | -> | Plus |
X | 480030..480166 | 379..515 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 479446..479509 | 1..62 | 96 | -> | Plus |
X | 479630..479945 | 63..378 | 100 | -> | Plus |
X | 480030..480166 | 379..515 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 479446..479509 | 1..62 | 96 | -> | Plus |
X | 479630..479945 | 63..378 | 100 | -> | Plus |
X | 480030..480166 | 379..515 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_X | 373479..373542 | 1..62 | 96 | -> | Plus |
arm_X | 373663..373978 | 63..378 | 100 | -> | Plus |
arm_X | 374063..374199 | 379..515 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 487728..488043 | 63..378 | 100 | -> | Plus |
X | 488128..488264 | 379..515 | 100 | Plus | |
X | 487544..487607 | 1..62 | 96 | -> | Plus |
Translation from 1 to 383
> FI09234.hyp HCNLEILRVLIALLADLKQIKEDNQNAFRWRNRQWARSGPEYPESIGARP GGARPMRAVLSAGRWFHHSAQPFHRLVESAPEIALLPAPNTHPRHMRQLR DGSLRGVWLLLRRVRQVYLPQLRDFIW*
Translation from 76 to 441
> FI09234.pep MLFDGATGNGHGQGQNTLNPLGPGQEEPALCEQYYLLGDGSIILRNHSID LSNPPLKSRCCQLPTLIHDICVNCVMDLCEECGYSCGECAKFICRNCVTL FGNRIEEEEAPLCEHCQMFLS*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF21455-PA | 230 | GF21455-PA | 136..230 | 30..121 | 354 | 69.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG12788-PA | 389 | GG12788-PA | 285..389 | 20..121 | 423 | 75.2 | Plus |
Dere\GG12787-PA | 121 | GG12787-PA | 17..121 | 20..121 | 407 | 75.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH24415-PA | 114 | GH24415-PA | 3..114 | 13..121 | 304 | 57.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG32817-PB | 121 | CG32817-PB | 1..121 | 1..121 | 683 | 100 | Plus |
CG32817-PC | 121 | CG32817-PC | 1..121 | 1..121 | 683 | 100 | Plus |
CG32817-PA | 121 | CG32817-PA | 1..121 | 1..121 | 683 | 100 | Plus |
CG3176-PD | 121 | CG3176-PD | 1..121 | 1..121 | 664 | 97.5 | Plus |
CG3176-PA | 121 | CG3176-PA | 1..121 | 1..121 | 664 | 97.5 | Plus |
CG3176-PC | 101 | CG3176-PC | 1..100 | 1..100 | 553 | 98 | Plus |
CG3176-PB | 101 | CG3176-PB | 1..100 | 1..100 | 553 | 98 | Plus |
CG13373-PA | 124 | CG13373-PA | 1..124 | 1..121 | 549 | 80.6 | Plus |
CG13373-PB | 177 | CG13373-PB | 54..177 | 1..121 | 549 | 80.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI16312-PA | 176 | GI16312-PA | 50..176 | 1..121 | 330 | 55.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL20383-PA | 78 | GL20383-PA | 2..78 | 48..121 | 241 | 62.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12237-PA | 143 | GA12237-PA | 27..141 | 4..119 | 285 | 50.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM16244-PA | 122 | GM16244-PA | 1..122 | 1..121 | 532 | 86.1 | Plus |
Dsec\GM16243-PA | 122 | GM16243-PA | 1..122 | 1..121 | 532 | 86.1 | Plus |
Dsec\GM19067-PA | 122 | GM19067-PA | 1..122 | 1..121 | 532 | 86.1 | Plus |
Dsec\GM19066-PA | 234 | GM19066-PA | 54..157 | 1..101 | 442 | 79.8 | Plus |
Dsec\GM23227-PA | 104 | GM23227-PA | 1..96 | 1..95 | 419 | 86.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD16505-PA | 177 | GD16505-PA | 54..177 | 1..121 | 527 | 79 | Plus |
Dsim\GD16506-PA | 122 | GD16506-PA | 1..122 | 1..121 | 487 | 82 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ15649-PA | 207 | GJ15649-PA | 113..207 | 30..121 | 332 | 67.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK15991-PA | 180 | GK15991-PA | 50..178 | 1..119 | 311 | 53.5 | Plus |
Dwil\GK15987-PA | 158 | GK15987-PA | 59..158 | 28..121 | 279 | 61 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE16613-PA | 324 | GE16613-PA | 226..324 | 26..121 | 393 | 73.7 | Plus |