Clone FI09234 Report

Search the DGRC for FI09234

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:92
Well:34
Vector:pFlc-1
Associated Gene/TranscriptCG32817-RA
Protein status:FI09234.pep: gold
Sequenced Size:548

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32817 2008-08-15 Release 5.9 accounting
CG32817 2008-12-18 5.12 accounting

Clone Sequence Records

FI09234.complete Sequence

548 bp assembled on 2008-07-25

GenBank Submission: BT032675

> FI09234.complete
GCTTGCAATTTGGAAATTTTAAGGGTTCTGATTGCACTTCTCGCTGACCT
CAAACAAATCAAAGAAGACAATCAAAATGCTTTTCGATGGCGCAACCGGC
AATGGGCACGGTCAGGGCCAGAATACCCTGAATCCATTGGGGCCAGGCCA
GGAGGAGCCCGCCCTATGCGAGCAGTACTATCTGCTGGGCGATGGTTCCA
TCATTCTGCGCAACCATTCCATCGACTTGTCGAATCCGCCCCTGAAATCG
CGCTGCTGCCAGCTCCCAACACTCATCCACGACATATGCGTCAACTGCGT
GATGGATCTCTGCGAGGAGTGTGGCTACTCCTGCGGCGAGTGCGCCAAGT
TTATTTGCCGCAACTGCGTGACTTTATTTGGTAATCGAATTGAAGAAGAG
GAGGCTCCGCTGTGCGAGCACTGCCAGATGTTCCTCAGCTAGGGCATCAA
ACAATCAAGCAAATGTCAAATGTATTACGTTTTAAAGAATATAGAGCTAT
ATAGTATTTAACATTAAAAAAAAAAAAAAAAAAGAAAAAAAAAAAAAA

FI09234.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:02:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG32817.c 1561 CG32817.c 46..567 3..524 2580 99.6 Plus
CG32817.b 1840 CG32817.b 325..846 3..524 2580 99.6 Plus
CG32817.d 1568 CG32817.d 113..574 63..524 2280 99.5 Plus
CG32817.d 1568 CG32817.d 5..64 3..62 300 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:33:34
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 373663..373978 63..378 1580 100 Plus
chrX 22417052 chrX 376151..376466 63..378 1550 99.4 Plus
chrX 22417052 chrX 371640..371964 63..378 1110 90.2 Plus
chrX 22417052 chrX 374063..374208 379..524 700 98.6 Plus
chrX 22417052 chrX 376551..376688 379..516 675 99.3 Plus
chrX 22417052 chrX 373483..373542 3..62 300 100 Plus
chrX 22417052 chrX 375971..376030 3..62 300 100 Plus
chrX 22417052 chrX 372046..372128 379..461 265 88 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:21:45 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:33:32
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 479630..479945 63..378 1580 100 Plus
X 23542271 X 482118..482433 63..378 1550 99.4 Plus
X 23542271 X 477607..477931 63..378 1110 90.2 Plus
X 23542271 X 480030..480175 379..524 700 98.6 Plus
X 23542271 X 482518..482655 379..516 675 99.3 Plus
X 23542271 X 479450..479509 3..62 300 100 Plus
X 23542271 X 481938..481997 3..62 300 100 Plus
X 23542271 X 478013..478095 379..461 265 88 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:20:41
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 487728..488043 63..378 1580 100 Plus
X 23527363 X 490216..490531 63..378 1550 99.3 Plus
X 23527363 X 488128..488273 379..524 700 98.6 Plus
X 23527363 X 490616..490753 379..516 675 99.2 Plus
X 23527363 X 485705..485886 63..244 670 91.2 Plus
X 23527363 X 485894..486029 243..378 575 94.8 Plus
X 23527363 X 487548..487607 3..62 300 100 Plus
X 23527363 X 490036..490095 3..62 300 100 Plus
X 23527363 X 486111..486193 379..461 265 87.9 Plus
Blast to na_te.dros performed on 2019-03-16 20:33:33 has no hits.

FI09234.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:34:49 Download gff for FI09234.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 373479..373542 1..62 96 -> Plus
chrX 373663..373978 63..378 100 -> Plus
chrX 374063..374199 379..515 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:59:54 Download gff for FI09234.complete
Subject Subject Range Query Range Percent Splice Strand
CG32817-RB 1..366 77..442 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:02:46 Download gff for FI09234.complete
Subject Subject Range Query Range Percent Splice Strand
CG32817-RB 1..366 77..442 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:10:35 Download gff for FI09234.complete
Subject Subject Range Query Range Percent Splice Strand
CG32817-RA 1..366 77..442 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:46:37 Download gff for FI09234.complete
Subject Subject Range Query Range Percent Splice Strand
CG32817-RA 1..366 77..442 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:06:32 Download gff for FI09234.complete
Subject Subject Range Query Range Percent Splice Strand
CG32817-RA 1..366 77..442 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:22:07 Download gff for FI09234.complete
Subject Subject Range Query Range Percent Splice Strand
CG32817-RA 1..517 1..515 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:02:46 Download gff for FI09234.complete
Subject Subject Range Query Range Percent Splice Strand
CG32817-RA 1..517 1..515 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:10:35 Download gff for FI09234.complete
Subject Subject Range Query Range Percent Splice Strand
CG32817-RA 16..532 1..515 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-25 13:46:30 Download gff for FI09234.complete
Subject Subject Range Query Range Percent Splice Strand
CG32817-RA 1..517 1..515 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:06:32 Download gff for FI09234.complete
Subject Subject Range Query Range Percent Splice Strand
CG32817-RA 16..532 1..515 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:34:49 Download gff for FI09234.complete
Subject Subject Range Query Range Percent Splice Strand
X 479446..479509 1..62 96 -> Plus
X 479630..479945 63..378 100 -> Plus
X 480030..480166 379..515 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:34:49 Download gff for FI09234.complete
Subject Subject Range Query Range Percent Splice Strand
X 479446..479509 1..62 96 -> Plus
X 479630..479945 63..378 100 -> Plus
X 480030..480166 379..515 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:34:49 Download gff for FI09234.complete
Subject Subject Range Query Range Percent Splice Strand
X 479446..479509 1..62 96 -> Plus
X 479630..479945 63..378 100 -> Plus
X 480030..480166 379..515 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:10:35 Download gff for FI09234.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 373479..373542 1..62 96 -> Plus
arm_X 373663..373978 63..378 100 -> Plus
arm_X 374063..374199 379..515 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:30:38 Download gff for FI09234.complete
Subject Subject Range Query Range Percent Splice Strand
X 487728..488043 63..378 100 -> Plus
X 488128..488264 379..515 100   Plus
X 487544..487607 1..62 96 -> Plus

FI09234.hyp Sequence

Translation from 1 to 383

> FI09234.hyp
HCNLEILRVLIALLADLKQIKEDNQNAFRWRNRQWARSGPEYPESIGARP
GGARPMRAVLSAGRWFHHSAQPFHRLVESAPEIALLPAPNTHPRHMRQLR
DGSLRGVWLLLRRVRQVYLPQLRDFIW*
Sequence FI09234.hyp has no blast hits.

FI09234.pep Sequence

Translation from 76 to 441

> FI09234.pep
MLFDGATGNGHGQGQNTLNPLGPGQEEPALCEQYYLLGDGSIILRNHSID
LSNPPLKSRCCQLPTLIHDICVNCVMDLCEECGYSCGECAKFICRNCVTL
FGNRIEEEEAPLCEHCQMFLS*

FI09234.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:37:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21455-PA 230 GF21455-PA 136..230 30..121 354 69.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:37:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12788-PA 389 GG12788-PA 285..389 20..121 423 75.2 Plus
Dere\GG12787-PA 121 GG12787-PA 17..121 20..121 407 75.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:37:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24415-PA 114 GH24415-PA 3..114 13..121 304 57.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:31:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG32817-PB 121 CG32817-PB 1..121 1..121 683 100 Plus
CG32817-PC 121 CG32817-PC 1..121 1..121 683 100 Plus
CG32817-PA 121 CG32817-PA 1..121 1..121 683 100 Plus
CG3176-PD 121 CG3176-PD 1..121 1..121 664 97.5 Plus
CG3176-PA 121 CG3176-PA 1..121 1..121 664 97.5 Plus
CG3176-PC 101 CG3176-PC 1..100 1..100 553 98 Plus
CG3176-PB 101 CG3176-PB 1..100 1..100 553 98 Plus
CG13373-PA 124 CG13373-PA 1..124 1..121 549 80.6 Plus
CG13373-PB 177 CG13373-PB 54..177 1..121 549 80.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:37:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16312-PA 176 GI16312-PA 50..176 1..121 330 55.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:37:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20383-PA 78 GL20383-PA 2..78 48..121 241 62.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:37:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12237-PA 143 GA12237-PA 27..141 4..119 285 50.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:37:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16244-PA 122 GM16244-PA 1..122 1..121 532 86.1 Plus
Dsec\GM16243-PA 122 GM16243-PA 1..122 1..121 532 86.1 Plus
Dsec\GM19067-PA 122 GM19067-PA 1..122 1..121 532 86.1 Plus
Dsec\GM19066-PA 234 GM19066-PA 54..157 1..101 442 79.8 Plus
Dsec\GM23227-PA 104 GM23227-PA 1..96 1..95 419 86.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:37:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16505-PA 177 GD16505-PA 54..177 1..121 527 79 Plus
Dsim\GD16506-PA 122 GD16506-PA 1..122 1..121 487 82 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:37:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15649-PA 207 GJ15649-PA 113..207 30..121 332 67.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:37:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15991-PA 180 GK15991-PA 50..178 1..119 311 53.5 Plus
Dwil\GK15987-PA 158 GK15987-PA 59..158 28..121 279 61 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:37:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16613-PA 324 GE16613-PA 226..324 26..121 393 73.7 Plus