Clone FI09235 Report

Search the DGRC for FI09235

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:92
Well:35
Vector:pFlc-1
Associated Gene/TranscriptLac-RB
Protein status:FI09235.pep: wuzgold
Sequenced Size:1537

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Lac 2008-12-18 5.12 accounting

Clone Sequence Records

FI09235.complete Sequence

1537 bp assembled on 2008-08-28

GenBank Submission: BT044422.1

> FI09235.complete
GATATTAAATCGCGCGCTTGCAGGGTGTGGTGCTAAAAGTCAATTTCTAA
GATGTGGCGGCCGAGTATCTCGAATTGCGTGTGGAGCACCCTGCTCCTGG
CCATTTTTGTGCAGCAAACGCTAGCACAGCGAACCCCGACCATATCCTAC
ATCACGCAGGAGCAGATCAAGGATATCGGCGGCACAGTGGAGTTCGATTG
CTCCGTCCAGTATGCCAAAGAGTACAACGTGCTGTTCCTGAAGACGGACA
GCGATCCCGTCTTCCTCTCCACGGGCTCCACGCTGGTCATCAAGGATTCG
CGCTTCTCGCTGCGGTACGATCCCAACTCGTCCACCTACAAGCTGCAGAT
CAAGGACATTCAGGAGACGGACGCGGGCACCTACACCTGCCAGGTGGAGT
TCGCACCAGTGATCACCGTGCCGCGTCCTCGTTTGGGACAGGCTCTGCAG
TACGACATGGACTTGGAGTGCCACATTGAGGCCTATCCGCCACCGGCCAT
TGTGTGGACCAAGGACGACATCCAGCTGGCCAACAACCAGCACTACAGCA
TCTCGCACTTCGCCACCGCCGACGAGTATACCGACTCGACGCTCCGTGTG
ATCACCGTTGAGAAGCGCCAGTACGGAGATTATGTGTGCAAGGCCACCAA
TCGCTTTGGAGAGGCGGAGGCGCGCGTCAATCTCTTCGAGACGATCATTC
CCGTGTGCCCACCGGCCTGTGGACAGGCGTACATCGCCGGAGCCGAGGAT
GTGTCCGCCACTTCGTTCGCTCTTGTGGGCATCCTGGCGGCGTTGCTCTT
CGCCAGATAAGCCAATGGGCCCACGGCCGTCGACTCCAAGCGCTTCAGGT
CCAATCCATCAACCAGCCCTCGAATGCATAAAACATATATAAAATAGATA
TATCGAAAACAAACATCGTGTAACCGCGCAATAGATGTCTCAAACGATTT
CGGACACACCAACCCACATCCAGTTCTCAGTTCGTTTTGTAGCTTCTGCT
TCCGTTTCCGTATAGTCCAGCCCAATTTTTGTACGTCCAATATTATGTCT
TAAGTTAAGTATGATAAGTGAAGGGCCAACGATAACTAGACTATAATTTA
TTAGCACCCTAGAGCCGAACTCAAACCGAAATTAGACTCCAGCCCAGCCG
TAAACGATGCATTTCACCTTGATCCCGTCCGTTTTGCTTTCTGATCTGGC
ACTGTATATGTTTTAAATATTTTAATCTAAGCAAGATACATCACAAGCAT
TCCGATTTTGCTTCGACAATTGAGAGGATATTTTATTTTTATTTAATAAT
AATAAAGTATTTTCGTTACGCAAACCTATCAGCTCGACACACTATTCCCT
AAATAATATCTCAACCCCCATAATCGAGGCAAAATCCATATTCGAATAAA
AGGCAACAAAAGTTGTGTACATTATTAGCTCATAAGCACAATGAGAAATT
CTTTTGAATAACAAGACATTTTTACCCAAATTTTTGTGTGGGTGTGAGTA
AAATCAATTTCGACTTTGTAACAAAAAAAAAAAAAAA

FI09235.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:08:02
Subject Length Description Subject Range Query Range Score Percent Strand
Lac-RB 1853 Lac-RB 277..1810 2..1535 7670 100 Plus
Lac-RA 2340 Lac-RA 1154..2297 392..1535 5720 100 Plus
Lac-RA 2340 Lac-RA 443..838 2..397 1980 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:37:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 8351749..8352879 392..1522 5520 99.2 Plus
chr2R 21145070 chr2R 8340703..8341098 2..397 1965 99.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:21:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:37:35
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12464463..12465606 392..1535 5720 100 Plus
2R 25286936 2R 12453467..12453862 2..397 1980 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:26:09
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12465662..12466805 392..1535 5720 100 Plus
2R 25260384 2R 12454666..12455061 2..397 1980 100 Plus
Blast to na_te.dros performed 2019-03-16 20:37:36
Subject Length Description Subject Range Query Range Score Percent Strand
TART-A 13424 TART-A 13424bp 1930..1991 1339..1278 112 64.5 Minus

FI09235.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:38:34 Download gff for FI09235.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 8340702..8341094 1..393 99 -> Plus
chr2R 8351751..8352876 394..1522 96   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 16:46:08 Download gff for FI09235.complete
Subject Subject Range Query Range Percent Splice Strand
Lac-RB 1..759 52..810 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:11:42 Download gff for FI09235.complete
Subject Subject Range Query Range Percent Splice Strand
Lac-RB 1..759 52..810 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:11:39 Download gff for FI09235.complete
Subject Subject Range Query Range Percent Splice Strand
Lac-RA 1..342 52..393 100 -> Plus
Lac-RA 664..1080 394..810 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:19:54 Download gff for FI09235.complete
Subject Subject Range Query Range Percent Splice Strand
Lac-RB 1..759 52..810 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:08:13 Download gff for FI09235.complete
Subject Subject Range Query Range Percent Splice Strand
Lac-RA 1..342 52..393 100 -> Plus
Lac-RA 664..1080 394..810 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:46:07 Download gff for FI09235.complete
Subject Subject Range Query Range Percent Splice Strand
Lac-RB 276..1797 1..1522 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:11:41 Download gff for FI09235.complete
Subject Subject Range Query Range Percent Splice Strand
Lac-RB 276..1797 1..1522 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:11:39 Download gff for FI09235.complete
Subject Subject Range Query Range Percent Splice Strand
Lac-RA 277..669 1..393 99 -> Plus
Lac-RA 991..2119 394..1522 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-28 18:06:03 Download gff for FI09235.complete
Subject Subject Range Query Range Percent Splice Strand
Lac-RB 276..1797 1..1522 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:08:13 Download gff for FI09235.complete
Subject Subject Range Query Range Percent Splice Strand
Lac-RA 277..669 1..393 99 -> Plus
Lac-RA 991..2119 394..1522 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:38:34 Download gff for FI09235.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12453466..12453858 1..393 99 -> Plus
2R 12464465..12465593 394..1522 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:38:34 Download gff for FI09235.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12453466..12453858 1..393 99 -> Plus
2R 12464465..12465593 394..1522 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:38:34 Download gff for FI09235.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12453466..12453858 1..393 99 -> Plus
2R 12464465..12465593 394..1522 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:11:39 Download gff for FI09235.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8340971..8341363 1..393 99 -> Plus
arm_2R 8351970..8353098 394..1522 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:42:00 Download gff for FI09235.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12454665..12455057 1..393 99 -> Plus
2R 12465664..12466792 394..1522 100   Plus

FI09235.hyp Sequence

Translation from 51 to 809

> FI09235.hyp
MWRPSISNCVWSTLLLAIFVQQTLAQRTPTISYITQEQIKDIGGTVEFDC
SVQYAKEYNVLFLKTDSDPVFLSTGSTLVIKDSRFSLRYDPNSSTYKLQI
KDIQETDAGTYTCQVEFAPVITVPRPRLGQALQYDMDLECHIEAYPPPAI
VWTKDDIQLANNQHYSISHFATADEYTDSTLRVITVEKRQYGDYVCKATN
RFGEAEARVNLFETIIPVCPPACGQAYIAGAEDVSATSFALVGILAALLF
AR*

FI09235.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:45:57
Subject Length Description Subject Range Query Range Score Percent Strand
Lac-PA 359 CG12369-PA 132..359 26..252 758 68.2 Plus
Lac-PA 359 CG12369-PA 1..238 1..226 672 59.1 Plus
Ama-PC 333 CG2198-PC 122..329 5..218 278 27.7 Plus
Ama-PA 333 CG2198-PA 122..329 5..218 278 27.7 Plus
Ama-PB 341 CG2198-PB 130..337 5..218 278 27.7 Plus
Ama-PC 333 CG2198-PC 14..221 16..209 184 26 Plus
Ama-PA 333 CG2198-PA 14..221 16..209 184 26 Plus
Ama-PB 341 CG2198-PB 22..229 16..209 184 26 Plus
CG32791-PB 432 CG32791-PB 24..217 33..213 165 24.3 Plus

FI09235.pep Sequence

Translation from 51 to 809

> FI09235.pep
MWRPSISNCVWSTLLLAIFVQQTLAQRTPTISYITQEQIKDIGGTVEFDC
SVQYAKEYNVLFLKTDSDPVFLSTGSTLVIKDSRFSLRYDPNSSTYKLQI
KDIQETDAGTYTCQVEFAPVITVPRPRLGQALQYDMDLECHIEAYPPPAI
VWTKDDIQLANNQHYSISHFATADEYTDSTLRVITVEKRQYGDYVCKATN
RFGEAEARVNLFETIIPVCPPACGQAYIAGAEDVSATSFALVGILAALLF
AR*

FI09235.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 12:21:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12514-PA 359 GF12514-PA 180..359 92..252 744 78.9 Plus
Dana\GF12514-PA 359 GF12514-PA 1..238 1..226 623 54.7 Plus
Dana\GF17188-PA 334 GF17188-PA 123..330 5..218 262 28.2 Plus
Dana\GF17188-PA 334 GF17188-PA 10..222 14..209 213 27.8 Plus
Dana\GF22310-PA 554 GF22310-PA 124..321 33..217 167 24.3 Plus
Dana\GF22082-PA 499 GF22082-PA 117..286 43..200 157 23.9 Plus
Dana\GF21699-PA 655 GF21699-PA 83..249 42..200 156 25.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 12:21:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20306-PA 330 GG20306-PA 1..330 1..252 1035 67.3 Plus
Dere\GG13665-PA 333 GG13665-PA 122..329 5..218 278 28.2 Plus
Dere\GG13665-PA 333 GG13665-PA 14..221 16..209 197 26.5 Plus
Dere\GG18577-PA 555 GG18577-PA 146..343 33..217 167 24.3 Plus
Dere\GG24038-PA 537 GG24038-PA 132..301 43..200 157 23.9 Plus
Dere\GG10188-PA 672 GG10188-PA 87..253 42..200 156 25.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 12:21:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21969-PA 180 GH21969-PA 9..160 86..234 682 82.9 Plus
Dgri\GH21968-PA 164 GH21968-PA 26..145 25..156 503 75.8 Plus
Dgri\GH18131-PA 337 GH18131-PA 196..332 98..218 272 40.9 Plus
Dgri\GH18131-PA 337 GH18131-PA 27..224 25..209 209 26.9 Plus
Dgri\GH24041-PA 569 GH24041-PA 146..343 33..217 162 24.3 Plus
Dgri\GH13645-PA 518 GH13645-PA 119..288 43..200 156 23.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:02:44
Subject Length Description Subject Range Query Range Score Percent Strand
Lac-PA 359 CG12369-PA 132..359 26..252 758 68.2 Plus
Lac-PA 359 CG12369-PA 1..238 1..226 672 59.1 Plus
Ama-PC 333 CG2198-PC 122..329 5..218 278 27.7 Plus
Ama-PA 333 CG2198-PA 122..329 5..218 278 27.7 Plus
Ama-PB 341 CG2198-PB 130..337 5..218 278 27.7 Plus
Ama-PC 333 CG2198-PC 14..221 16..209 184 26 Plus
Ama-PA 333 CG2198-PA 14..221 16..209 184 26 Plus
Ama-PB 341 CG2198-PB 22..229 16..209 184 26 Plus
DIP-alpha-PB 432 CG32791-PB 24..217 33..213 165 24.3 Plus
DIP-alpha-PC 554 CG32791-PC 146..339 33..213 165 24.3 Plus
DIP-alpha-PA 554 CG32791-PA 146..339 33..213 165 24.3 Plus
DIP-gamma-PA 413 CG14521-PA 60..243 50..218 161 25.8 Plus
DIP-delta-PE 469 CG34391-PE 186..342 75..220 159 25 Plus
DIP-delta-PD 469 CG34391-PD 186..342 75..220 159 25 Plus
CG31814-PB 643 CG31814-PB 87..253 42..200 153 26.4 Plus
CG31814-PA 672 CG31814-PA 87..253 42..200 153 26.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 12:21:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19672-PA 363 GI19672-PA 134..363 26..252 670 60.5 Plus
Dmoj\GI19672-PA 363 GI19672-PA 1..240 1..226 554 53 Plus
Dmoj\GI22890-PA 220 GI22890-PA 19..217 25..218 378 37.2 Plus
Dmoj\GI24529-PA 411 GI24529-PA 59..242 50..218 178 27.8 Plus
Dmoj\GI10093-PA 691 GI10093-PA 82..248 42..200 158 25.8 Plus
Dmoj\GI11934-PA 527 GI11934-PA 129..298 43..200 157 23.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 12:21:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17135-PA 355 GL17135-PA 186..355 92..252 671 73.9 Plus
Dper\GL17135-PA 355 GL17135-PA 1..244 1..226 561 52.6 Plus
Dper\GL21774-PA 329 GL21774-PA 118..325 5..218 294 27.8 Plus
Dper\GL21774-PA 329 GL21774-PA 26..217 29..209 212 27.7 Plus
Dper\GL25539-PA 523 GL25539-PA 115..284 43..200 156 23.9 Plus
Dper\GL21154-PA 481 GL21154-PA 33..220 36..213 148 24.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 12:21:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11586-PB 258 GA11586-PB 1..258 1..252 1211 89.5 Plus
Dpse\GA11586-PA 360 GA11586-PA 181..360 92..252 751 79.4 Plus
Dpse\GA11586-PA 360 GA11586-PA 23..239 22..226 541 54.9 Plus
Dpse\Ama-PB 329 GA15295-PB 118..325 5..218 295 27.8 Plus
Dpse\Ama-PB 329 GA15295-PB 22..217 25..209 214 27.7 Plus
Dpse\GA23218-PA 565 GA23218-PA 142..339 33..217 167 24.3 Plus
Dpse\GA16498-PA 684 GA16498-PA 93..259 42..200 160 26.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 12:21:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21394-PA 173 GM21394-PA 10..173 91..252 787 90.9 Plus
Dsec\GM21393-PA 215 GM21393-PA 1..144 1..156 628 78.2 Plus
Dsec\GM10913-PA 333 GM10913-PA 122..329 5..218 269 27.7 Plus
Dsec\GM10913-PA 333 GM10913-PA 12..221 14..209 208 26.2 Plus
Dsec\GM12720-PA 550 GM12720-PA 146..343 33..217 171 24.8 Plus
Dsec\GM25389-PA 675 GM25389-PA 87..253 42..200 159 26.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 12:21:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10890-PA 173 GD10890-PA 10..173 91..252 787 90.9 Plus
Dsim\GD10889-PA 215 GD10889-PA 1..144 1..156 627 78.2 Plus
Dsim\Ama-PA 333 GD19894-PA 122..329 5..218 270 27.7 Plus
Dsim\Ama-PA 333 GD19894-PA 12..221 14..209 194 25.3 Plus
Dsim\GD16325-PA 648 GD16325-PA 244..441 33..217 169 24.3 Plus
Dsim\GD22051-PA 675 GD22051-PA 87..253 42..200 159 26.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 12:21:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15038-PA 365 GJ15038-PA 136..365 26..252 708 61.3 Plus
Dvir\GJ15038-PA 365 GJ15038-PA 29..242 25..226 537 53.8 Plus
Dvir\GJ23304-PA 331 GJ23304-PA 191..327 98..218 271 40.1 Plus
Dvir\GJ23304-PA 331 GJ23304-PA 22..219 25..209 211 26.1 Plus
Dvir\GJ17840-PA 193 GJ17840-PA 22..174 25..155 180 26.8 Plus
Dvir\GJ15333-PA 556 GJ15333-PA 146..343 33..217 162 24.3 Plus
Dvir\GJ14067-PA 518 GJ14067-PA 115..284 43..200 157 23.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 12:21:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22188-PA 352 GK22188-PA 125..352 26..252 729 63.1 Plus
Dwil\GK22188-PA 352 GK22188-PA 1..231 10..226 563 52.1 Plus
Dwil\GK12252-PA 330 GK12252-PA 190..326 98..218 289 37.2 Plus
Dwil\GK12252-PA 330 GK12252-PA 1..218 6..209 200 24.9 Plus
Dwil\GK16718-PA 551 GK16718-PA 146..343 33..217 165 24.8 Plus
Dwil\GK24547-PA 614 GK24547-PA 74..240 42..200 157 25.8 Plus
Dwil\GK23705-PA 528 GK23705-PA 118..287 43..200 154 23.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 12:21:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12466-PA 359 GE12466-PA 132..359 26..252 780 68.2 Plus
Dyak\GE12466-PA 359 GE12466-PA 1..238 1..226 685 60.3 Plus
Dyak\GE24882-PA 333 GE24882-PA 122..329 5..218 271 28.2 Plus
Dyak\GE24882-PA 333 GE24882-PA 12..221 14..209 205 26.2 Plus
Dyak\GE16888-PA 551 GE16888-PA 146..343 33..217 167 24.3 Plus
Dyak\GE11503-PA 661 GE11503-PA 87..253 42..200 159 26.4 Plus
Dyak\GE10621-PA 535 GE10621-PA 128..297 43..200 157 23.9 Plus