Clone FI09311 Report

Search the DGRC for FI09311

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:93
Well:11
Vector:pFlc-1
Associated Gene/TranscriptCG4592-RA
Protein status:FI09311.pep: gold
Sequenced Size:1021

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4592 2008-12-18 5.12 accounting

Clone Sequence Records

FI09311.complete Sequence

1021 bp assembled on 2008-08-28

GenBank Submission: BT044423.1

> FI09311.complete
TTTTGCAACTCGACTTAATATATGATAAACAGGTTAATTTGTTTAAATTC
CTGCCCGTCGCTCAGTGCGTGATTGCTGCTCCAGATCCAAAGTCGTCCAA
GTCATGTTGCGTAACAGGCTGATAGATGGAGTCAGGCGAATAAAACCCAT
ACTTTGCGGGGGGCAATCCCTGCGATCCCTTGCCAATGGCGCGACTTCAA
AGCTGACAACCATAGAGGTCGATGATAGGAGTGGGATTGCCACTCTGTCA
ATGAACCTGCCACCGGTGAACACTTTGACCATGGAGCTGATGCACGACCT
CATCGATTCAATCAATCAGATTGAGAGCAACAAGAGCCGCGGTCTCATCC
TGACTTCAAGCAATGACAAGGTCTTCTCCGCCGGCCTCGATCTCAACGAG
ATGCTGAATCCGGATGTGGAGCGACTGCGATTATTCTGGACTCGGTTCCA
GGATTTGTGGCTGGCCCTCCATCTTTGTGGCCTTCCCACAGCAGCGGCAA
TCAATGGACACTCACCTGCCGCAGGCTGTGTCCTGGCAACCGCCTGTGAG
TATCGCGTGATGTTGCCGAATCTCTTTATCGGTATACATGCCACCCGGTT
TAGCTTCGTCATCTCGAAGTGGATGATGAACTCGTACCAGAGCGTTCTAC
CCCGCAGAATTGTGGAGCGAGCGCTGAATCAAGGTAAGCTCTTCGCCAGC
CAGGAAGCTCTGGATGTGGGCCTTGTGGACGAGATCGCGTGTAGCAAAGA
GGAAGCGCTCTCCAAGTGCGCAGCCTTCATAGCCACCTTTGACAAGACCA
ACCCGGTGGCCAGGTGCCTAACCAAGCGAATGTGTCGGGAGCCAGATGTG
CGGGAGCTGCTTCAGGATAGAGCTGCGGATCTGAAGGAGTGCGTCGACTA
TGTCACTACTCCGCTATTCCAGGAGGGACTCTGTGCCCACTTGGAGGGTC
TCAAGAAGAGAAAATAGCGGACTGTTATAGGAATGTGATCAAATTGCATT
TATTGTAAAAAAAAAAAAAAA

FI09311.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:08:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG4592-RA 1189 CG4592-RA 118..1123 2..1007 5030 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:54:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 9921187..9921687 506..1006 2505 100 Plus
chr2L 23010047 chr2L 9920560..9920916 2..358 1785 100 Plus
chr2L 23010047 chr2L 9920985..9921132 359..506 740 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:21:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:54:45
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9922266..9922767 506..1007 2510 100 Plus
2L 23513712 2L 9921639..9921995 2..358 1785 100 Plus
2L 23513712 2L 9922064..9922211 359..506 740 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:26:31
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9922266..9922767 506..1007 2510 100 Plus
2L 23513712 2L 9921639..9921995 2..358 1785 100 Plus
2L 23513712 2L 9922064..9922211 359..506 740 100 Plus
Blast to na_te.dros performed on 2019-03-16 17:54:45 has no hits.

FI09311.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:55:41 Download gff for FI09311.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 9920559..9920916 1..358 99 -> Plus
chr2L 9920985..9921131 359..505 100 -> Plus
chr2L 9921187..9921687 506..1006 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:00:02 Download gff for FI09311.complete
Subject Subject Range Query Range Percent Splice Strand
CG4592-RA 1..864 104..967 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:12:16 Download gff for FI09311.complete
Subject Subject Range Query Range Percent Splice Strand
CG4592-RA 1..864 104..967 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:41:24 Download gff for FI09311.complete
Subject Subject Range Query Range Percent Splice Strand
CG4592-RA 1..864 104..967 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:20:07 Download gff for FI09311.complete
Subject Subject Range Query Range Percent Splice Strand
CG4592-RA 1..864 104..967 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:22:27 Download gff for FI09311.complete
Subject Subject Range Query Range Percent Splice Strand
CG4592-RA 1..864 104..967 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:09:48 Download gff for FI09311.complete
Subject Subject Range Query Range Percent Splice Strand
CG4592-RA 2..992 2..992 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:12:16 Download gff for FI09311.complete
Subject Subject Range Query Range Percent Splice Strand
CG4592-RA 1..1005 2..1006 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:41:24 Download gff for FI09311.complete
Subject Subject Range Query Range Percent Splice Strand
CG4592-RA 6..1011 1..1006 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-28 18:07:29 Download gff for FI09311.complete
Subject Subject Range Query Range Percent Splice Strand
CG4592-RA 2..992 2..992 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:22:27 Download gff for FI09311.complete
Subject Subject Range Query Range Percent Splice Strand
CG4592-RA 6..1011 1..1006 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:55:41 Download gff for FI09311.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9921638..9921995 1..358 99 -> Plus
2L 9922064..9922210 359..505 100 -> Plus
2L 9922266..9922766 506..1006 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:55:41 Download gff for FI09311.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9921638..9921995 1..358 99 -> Plus
2L 9922064..9922210 359..505 100 -> Plus
2L 9922266..9922766 506..1006 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:55:41 Download gff for FI09311.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9921638..9921995 1..358 99 -> Plus
2L 9922064..9922210 359..505 100 -> Plus
2L 9922266..9922766 506..1006 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:41:24 Download gff for FI09311.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9921638..9921995 1..358 99 -> Plus
arm_2L 9922064..9922210 359..505 100 -> Plus
arm_2L 9922266..9922766 506..1006 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:42:41 Download gff for FI09311.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9921638..9921995 1..358 99 -> Plus
2L 9922064..9922210 359..505 100 -> Plus
2L 9922266..9922766 506..1006 100   Plus

FI09311.hyp Sequence

Translation from 103 to 966

> FI09311.hyp
MLRNRLIDGVRRIKPILCGGQSLRSLANGATSKLTTIEVDDRSGIATLSM
NLPPVNTLTMELMHDLIDSINQIESNKSRGLILTSSNDKVFSAGLDLNEM
LNPDVERLRLFWTRFQDLWLALHLCGLPTAAAINGHSPAAGCVLATACEY
RVMLPNLFIGIHATRFSFVISKWMMNSYQSVLPRRIVERALNQGKLFASQ
EALDVGLVDEIACSKEEALSKCAAFIATFDKTNPVARCLTKRMCREPDVR
ELLQDRAADLKECVDYVTTPLFQEGLCAHLEGLKKRK*

FI09311.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:46:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG4592-PB 287 CG4592-PB 1..287 1..287 1475 100 Plus
CG4592-PA 287 CG4592-PA 1..287 1..287 1475 100 Plus
CG4598-PB 281 CG4598-PB 1..277 1..286 796 55.2 Plus
CG4598-PA 281 CG4598-PA 1..277 1..286 796 55.2 Plus
CG4594-PB 280 CG4594-PB 7..277 23..286 755 54.6 Plus

FI09311.pep Sequence

Translation from 103 to 966

> FI09311.pep
MLRNRLIDGVRRIKPILCGGQSLRSLANGATSKLTTIEVDDRSGIATLSM
NLPPVNTLTMELMHDLIDSINQIESNKSRGLILTSSNDKVFSAGLDLNEM
LNPDVERLRLFWTRFQDLWLALHLCGLPTAAAINGHSPAAGCVLATACEY
RVMLPNLFIGIHATRFSFVISKWMMNSYQSVLPRRIVERALNQGKLFASQ
EALDVGLVDEIACSKEEALSKCAAFIATFDKTNPVARCLTKRMCREPDVR
ELLQDRAADLKECVDYVTTPLFQEGLCAHLEGLKKRK*

FI09311.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 12:05:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15727-PA 286 GF15727-PA 1..286 1..287 1252 80.8 Plus
Dana\GF15725-PA 281 GF15725-PA 1..277 1..286 813 53.5 Plus
Dana\GF15726-PA 260 GF15726-PA 2..257 31..286 750 52.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 12:05:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10066-PA 287 GG10066-PA 1..287 1..287 1468 95.8 Plus
Dere\GG10064-PA 281 GG10064-PA 23..277 32..286 836 58.8 Plus
Dere\GG10065-PA 280 GG10065-PA 23..277 32..286 771 54.5 Plus
Dere\GG22562-PA 299 GG22562-PA 46..228 42..225 165 25.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 12:05:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11302-PA 281 GH11302-PA 1..278 1..286 830 55.2 Plus
Dgri\GH11303-PA 282 GH11303-PA 1..279 1..286 786 56.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:28:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG4592-PB 287 CG4592-PB 1..287 1..287 1475 100 Plus
CG4592-PA 287 CG4592-PA 1..287 1..287 1475 100 Plus
CG4598-PB 281 CG4598-PB 1..277 1..286 796 55.2 Plus
CG4598-PA 281 CG4598-PA 1..277 1..286 796 55.2 Plus
CG4594-PB 280 CG4594-PB 7..277 23..286 755 54.6 Plus
CG4594-PA 280 CG4594-PA 7..277 23..286 755 54.6 Plus
CG8778-PA 299 CG8778-PA 3..222 1..216 163 24.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 12:05:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17723-PA 286 GI17723-PA 1..283 1..286 839 59 Plus
Dmoj\GI17724-PA 262 GI17724-PA 5..259 32..286 791 55.7 Plus
Dmoj\GI17722-PA 281 GI17722-PA 29..278 37..286 771 58.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 12:05:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18945-PA 286 GL18945-PA 1..286 1..287 1248 79.8 Plus
Dper\GL18943-PA 280 GL18943-PA 1..277 1..286 827 54.5 Plus
Dper\GL18944-PA 214 GL18944-PA 6..210 33..286 557 43.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 12:05:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25867-PA 286 GA25867-PA 1..286 1..287 1248 79.8 Plus
Dpse\GA18288-PA 280 GA18288-PA 1..277 1..286 824 54.5 Plus
Dpse\GA25865-PA 280 GA25865-PA 23..276 33..286 757 53.9 Plus
Dpse\GA20005-PB 285 GA20005-PB 18..178 20..174 151 25 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 12:05:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17787-PA 287 GM17787-PA 1..287 1..287 1509 98.3 Plus
Dsec\GM17765-PA 281 GM17765-PA 23..277 32..286 821 57.6 Plus
Dsec\GM17776-PA 280 GM17776-PA 7..277 23..286 777 53.5 Plus
Dsec\GM20345-PA 233 GM20345-PA 2..162 60..225 150 25.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 12:05:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23639-PA 287 GD23639-PA 1..287 1..287 1497 97.6 Plus
Dsim\GD23637-PA 281 GD23637-PA 1..277 1..286 823 54.2 Plus
Dsim\GD23638-PA 280 GD23638-PA 7..277 23..286 782 53.5 Plus
Dsim\GD25824-PA 299 GD25824-PA 46..228 42..225 165 25.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 12:05:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17551-PA 284 GJ17551-PA 1..281 1..286 849 58 Plus
Dvir\GJ17550-PA 281 GJ17550-PA 24..278 32..286 795 58.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 12:05:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24255-PA 290 GK24255-PA 1..282 1..286 975 60.8 Plus
Dwil\GK24256-PA 287 GK24256-PA 1..273 1..280 908 60.4 Plus
Dwil\GK18281-PA 279 GK18281-PA 1..276 1..286 843 56.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 12:05:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18880-PA 287 GE18880-PA 1..287 1..287 1458 94.4 Plus
Dyak\GE18878-PA 281 GE18878-PA 23..277 32..286 835 58.4 Plus
Dyak\GE18879-PA 280 GE18879-PA 7..277 23..286 780 53.1 Plus
Dyak\GE13432-PA 299 GE13432-PA 46..228 42..225 166 26.1 Plus