FI09328.complete Sequence
427 bp assembled on 2008-07-24
GenBank Submission: BT032678
> FI09328.complete
GATTCAGTCAATACACATCGTGCAAAGACAACTTGATATCAATCGCTGCA
TACAAAAATGGATGGTGCCATTGCAATGAATCATGTGGTGGAATCCGACA
AGGAGAAGAGGCAATTTAAACTGAAAATTATGGAGCTCGAGCACGAAATG
AGGATGGAAAAGGATCCAGCTCGCGCCAAGATGATCGAGGAGCACATTGA
GAAATTGAAGAAACTGGATGAGGAGAACCAAAAGCGGAACTTGGAAATTG
CCAAGGCAAACGTGATGTTAATGACAGCGAATACAAAGTTTAGAGTGGGT
TATCATATTATTAACAACCTTTAAATCAAAATTGCTTCCAATAATGAATC
CCGGCAAGGCAAAGCTGCTTGCAGTTTTGATTAAAATGCCTTATTAATAA
ATTTCATGAACAAAAAAAAAAAAAAAA
FI09328.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:01:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32368-RA | 419 | CG32368-RA | 2..419 | 2..419 | 2075 | 99.7 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:52:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 7907551..7907960 | 2..411 | 1960 | 98.5 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:21:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:52:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 7915437..7915854 | 2..419 | 2075 | 99.8 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:20:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 7908537..7908954 | 2..419 | 2075 | 99.7 | Plus |
Blast to na_te.dros performed on 2019-03-16 11:52:50 has no hits.
FI09328.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:53:40 Download gff for
FI09328.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 7907550..7907960 | 1..411 | 98 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:00:08 Download gff for
FI09328.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32368-RA | 1..267 | 58..324 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:02:35 Download gff for
FI09328.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32368-RA | 1..267 | 58..324 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:39:39 Download gff for
FI09328.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32368-RA | 1..267 | 58..324 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:51:25 Download gff for
FI09328.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32368-RA | 1..267 | 58..324 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:29:34 Download gff for
FI09328.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32368-RA | 1..267 | 58..324 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:21:49 Download gff for
FI09328.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32368-RA | 2..411 | 2..411 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:02:35 Download gff for
FI09328.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32368-RA | 1..410 | 2..411 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:39:39 Download gff for
FI09328.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32368-RA | 1..410 | 2..411 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-25 13:46:00 Download gff for
FI09328.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32368-RA | 2..411 | 2..411 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:29:34 Download gff for
FI09328.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32368-RA | 1..410 | 2..411 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:53:40 Download gff for
FI09328.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 7915436..7915846 | 1..411 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:53:40 Download gff for
FI09328.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 7915436..7915846 | 1..411 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:53:40 Download gff for
FI09328.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 7915436..7915846 | 1..411 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:39:39 Download gff for
FI09328.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 7908536..7908946 | 1..411 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:30:23 Download gff for
FI09328.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 7908536..7908946 | 1..411 | 99 | | Plus |
FI09328.pep Sequence
Translation from 57 to 323
> FI09328.pep
MDGAIAMNHVVESDKEKRQFKLKIMELEHEMRMEKDPARAKMIEEHIEKL
KKLDEENQKRNLEIAKANVMLMTANTKFRVGYHIINNL*
FI09328.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:43:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG14455-PA | 88 | GG14455-PA | 1..88 | 1..88 | 364 | 80.7 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:42:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32368-PA | 88 | CG32368-PA | 1..88 | 1..88 | 445 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:43:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM19392-PA | 40 | GM19392-PA | 1..39 | 1..39 | 185 | 92.3 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:43:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD14041-PA | 88 | GD14041-PA | 1..88 | 1..88 | 383 | 86.4 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:43:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE21645-PA | 88 | GE21645-PA | 1..88 | 1..88 | 370 | 80.7 | Plus |
FI09328.hyp Sequence
Translation from 57 to 323
> FI09328.hyp
MDGAIAMNHVVESDKEKRQFKLKIMELEHEMRMEKDPARAKMIEEHIEKL
KKLDEENQKRNLEIAKANVMLMTANTKFRVGYHIINNL*
FI09328.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:46:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32368-PA | 88 | CG32368-PA | 1..88 | 1..88 | 445 | 100 | Plus |