Clone FI09328 Report

Search the DGRC for FI09328

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:93
Well:28
Vector:pFlc-1
Associated Gene/TranscriptCG32368-RA
Protein status:FI09328.pep: gold
Sequenced Size:427

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32368 2008-08-15 Release 5.9 accounting
CG32368 2008-12-18 5.12 accounting

Clone Sequence Records

FI09328.complete Sequence

427 bp assembled on 2008-07-24

GenBank Submission: BT032678

> FI09328.complete
GATTCAGTCAATACACATCGTGCAAAGACAACTTGATATCAATCGCTGCA
TACAAAAATGGATGGTGCCATTGCAATGAATCATGTGGTGGAATCCGACA
AGGAGAAGAGGCAATTTAAACTGAAAATTATGGAGCTCGAGCACGAAATG
AGGATGGAAAAGGATCCAGCTCGCGCCAAGATGATCGAGGAGCACATTGA
GAAATTGAAGAAACTGGATGAGGAGAACCAAAAGCGGAACTTGGAAATTG
CCAAGGCAAACGTGATGTTAATGACAGCGAATACAAAGTTTAGAGTGGGT
TATCATATTATTAACAACCTTTAAATCAAAATTGCTTCCAATAATGAATC
CCGGCAAGGCAAAGCTGCTTGCAGTTTTGATTAAAATGCCTTATTAATAA
ATTTCATGAACAAAAAAAAAAAAAAAA

FI09328.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:01:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG32368-RA 419 CG32368-RA 2..419 2..419 2075 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:52:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 7907551..7907960 2..411 1960 98.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:21:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:52:49
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 7915437..7915854 2..419 2075 99.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:20:34
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 7908537..7908954 2..419 2075 99.7 Plus
Blast to na_te.dros performed on 2019-03-16 11:52:50 has no hits.

FI09328.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:53:40 Download gff for FI09328.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 7907550..7907960 1..411 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:00:08 Download gff for FI09328.complete
Subject Subject Range Query Range Percent Splice Strand
CG32368-RA 1..267 58..324 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:02:35 Download gff for FI09328.complete
Subject Subject Range Query Range Percent Splice Strand
CG32368-RA 1..267 58..324 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:39:39 Download gff for FI09328.complete
Subject Subject Range Query Range Percent Splice Strand
CG32368-RA 1..267 58..324 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:51:25 Download gff for FI09328.complete
Subject Subject Range Query Range Percent Splice Strand
CG32368-RA 1..267 58..324 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:29:34 Download gff for FI09328.complete
Subject Subject Range Query Range Percent Splice Strand
CG32368-RA 1..267 58..324 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:21:49 Download gff for FI09328.complete
Subject Subject Range Query Range Percent Splice Strand
CG32368-RA 2..411 2..411 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:02:35 Download gff for FI09328.complete
Subject Subject Range Query Range Percent Splice Strand
CG32368-RA 1..410 2..411 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:39:39 Download gff for FI09328.complete
Subject Subject Range Query Range Percent Splice Strand
CG32368-RA 1..410 2..411 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-25 13:46:00 Download gff for FI09328.complete
Subject Subject Range Query Range Percent Splice Strand
CG32368-RA 2..411 2..411 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:29:34 Download gff for FI09328.complete
Subject Subject Range Query Range Percent Splice Strand
CG32368-RA 1..410 2..411 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:53:40 Download gff for FI09328.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7915436..7915846 1..411 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:53:40 Download gff for FI09328.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7915436..7915846 1..411 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:53:40 Download gff for FI09328.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7915436..7915846 1..411 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:39:39 Download gff for FI09328.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 7908536..7908946 1..411 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:30:23 Download gff for FI09328.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7908536..7908946 1..411 99   Plus

FI09328.pep Sequence

Translation from 57 to 323

> FI09328.pep
MDGAIAMNHVVESDKEKRQFKLKIMELEHEMRMEKDPARAKMIEEHIEKL
KKLDEENQKRNLEIAKANVMLMTANTKFRVGYHIINNL*

FI09328.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:43:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14455-PA 88 GG14455-PA 1..88 1..88 364 80.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:42:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG32368-PA 88 CG32368-PA 1..88 1..88 445 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:43:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19392-PA 40 GM19392-PA 1..39 1..39 185 92.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:43:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14041-PA 88 GD14041-PA 1..88 1..88 383 86.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:43:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21645-PA 88 GE21645-PA 1..88 1..88 370 80.7 Plus

FI09328.hyp Sequence

Translation from 57 to 323

> FI09328.hyp
MDGAIAMNHVVESDKEKRQFKLKIMELEHEMRMEKDPARAKMIEEHIEKL
KKLDEENQKRNLEIAKANVMLMTANTKFRVGYHIINNL*

FI09328.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:46:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG32368-PA 88 CG32368-PA 1..88 1..88 445 100 Plus