Clone FI09344 Report

Search the DGRC for FI09344

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:93
Well:44
Vector:pFlc-1
Associated Gene/TranscriptCG42382-RA
Protein status:FI09344.pep: gold
Sequenced Size:909

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
rad201 2008-08-15 Release 5.9 accounting
CG42382 2008-12-18 5.12 accounting

Clone Sequence Records

FI09344.complete Sequence

909 bp assembled on 2008-07-29

GenBank Submission: BT032886

> FI09344.complete
GAGCTTATTTTTCACAACATATTGTTTTGGCTAGATCTATAAACAAAACA
ATAATAATGTCGCTGGTGGCAGATTATAGCGACTCCTCCGAATCCGATGA
AGACAGCAGTGGCCAATTTTCCGAAGACGGGGAAACAAAGAGTGCGGCAC
CAGCCAAAAATGAGAAGACTCCTCCTCCCAAGTTGCCCAGTGCTAGCCAA
GCTTTTTCCCAAGGAGCTGGAAAGGGAGATGTGTTTAACAATCCCTTCCT
GGAGGCCGAGCTGCATAAAACCGCGTCGCTGGAGCGGCACGTGAAGATGG
TCGACAACGACGCGCACCAAAAGTTGAAGAATGGCCGTAAGATTTGCTGG
AACTTTAGAAGGGGACGCTGCCGCTTTGGCACCAGTTGCCAGTATGCTCA
CGATTCCGACTTGTCGGTGGATGAGGCGGCGGAGAAGAGTGCATTACCGG
ATCAATCAGTGCCTGTGGTCGTAGAAGCTGCACCGGGTAATTTCAACAGG
CGTAAGCGCCCGGGTCTGGGCGATGCTCTGGAGCCGGGCAAACGGGTTAT
GAAGTCCTACAAACAGCAAAATCCGCAAAATCCATTTGCCCGGCGTTAGA
CCACGCCTGCATCCGTGATGCGCAGCAGACAGTGCTCACCATCAGGGCCA
TATGTGTTCGAGATGACGTAAATGAAACGCAGGCCATCGTCCTGGAGGGT
GAAGTCCTCTTCCTCTGGAAGCTCCACCGACAATCTGAGCGTGGCAACCG
AGCTCCAGTAGGATCCCAACATGGGCTCCAACTGCTGTCGTGTCACTTCC
TCATCGTCGCCATTGCTCTCCATCATCACCACAACTATCTATTAAGATAA
AGTTGTAAATAGTTTTAATTCCGTAATTTACAAGTGAAACTAGCAAAAAA
AAAAAAAAA

FI09344.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:05:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG42382-RA 1048 CG42382-RA 107..1002 2..895 4425 99.7 Plus
Rad51C-RB 1143 Rad51C-RB 895..1143 840..594 1190 99.1 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:18:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 5054132..5054887 894..141 3715 99.7 Minus
chr2R 21145070 chr2R 5054944..5055084 142..2 705 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:22:03 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:18:31
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9166565..9167321 895..141 3720 99.7 Minus
2R 25286936 2R 9167378..9167518 142..2 705 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:23:36
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 9167764..9168520 895..141 3730 99.7 Minus
2R 25260384 2R 9168577..9168717 142..2 705 100 Minus
Blast to na_te.dros performed on 2019-03-15 21:18:31 has no hits.

FI09344.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:19:33 Download gff for FI09344.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 5054132..5054885 143..894 99 <- Minus
chr2R 5054944..5055084 1..142 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:00:14 Download gff for FI09344.complete
Subject Subject Range Query Range Percent Splice Strand
CG42382-RA 1..543 57..599 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:07:37 Download gff for FI09344.complete
Subject Subject Range Query Range Percent Splice Strand
CG42382-RA 1..543 57..599 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:43:58 Download gff for FI09344.complete
Subject Subject Range Query Range Percent Splice Strand
CG42382-RA 1..543 57..599 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:51:34 Download gff for FI09344.complete
Subject Subject Range Query Range Percent Splice Strand
rad201-RA 1..543 57..599 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:49:29 Download gff for FI09344.complete
Subject Subject Range Query Range Percent Splice Strand
CG42382-RA 1..543 57..599 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:32:53 Download gff for FI09344.complete
Subject Subject Range Query Range Percent Splice Strand
CG42382-RA 1..895 2..894 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:07:37 Download gff for FI09344.complete
Subject Subject Range Query Range Percent Splice Strand
CG42382-RA 1..895 2..894 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:43:58 Download gff for FI09344.complete
Subject Subject Range Query Range Percent Splice Strand
CG42382-RA 1..885 12..894 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-29 09:19:28 Download gff for FI09344.complete
Subject Subject Range Query Range Percent Splice Strand
rad201-RA 1..895 2..894 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:49:29 Download gff for FI09344.complete
Subject Subject Range Query Range Percent Splice Strand
CG42382-RA 1..885 12..894 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:19:33 Download gff for FI09344.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9166566..9167319 143..894 99 <- Minus
2R 9167378..9167518 1..142 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:19:33 Download gff for FI09344.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9166566..9167319 143..894 99 <- Minus
2R 9167378..9167518 1..142 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:19:33 Download gff for FI09344.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9166566..9167319 143..894 99 <- Minus
2R 9167378..9167518 1..142 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:43:58 Download gff for FI09344.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5054071..5054824 143..894 99 <- Minus
arm_2R 5054883..5055023 1..142 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:36:57 Download gff for FI09344.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9167765..9168518 143..894 99 <- Minus
2R 9168577..9168717 1..142 99   Minus

FI09344.pep Sequence

Translation from 2 to 598

> FI09344.pep
AYFSQHIVLARSINKTIIMSLVADYSDSSESDEDSSGQFSEDGETKSAAP
AKNEKTPPPKLPSASQAFSQGAGKGDVFNNPFLEAELHKTASLERHVKMV
DNDAHQKLKNGRKICWNFRRGRCRFGTSCQYAHDSDLSVDEAAEKSALPD
QSVPVVVEAAPGNFNRRKRPGLGDALEPGKRVMKSYKQQNPQNPFARR*

FI09344.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:40:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11138-PA 173 GF11138-PA 1..173 19..191 572 67.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:40:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10575-PA 180 GG10575-PA 1..180 19..198 805 88.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:40:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19868-PA 191 GH19868-PA 1..188 19..198 494 61.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:43:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG42382-PA 180 CG8016-PA 1..180 19..198 947 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:40:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19818-PA 179 GI19818-PA 1..179 19..198 501 65.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:40:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18396-PA 133 GL18396-PA 21..133 58..180 322 54.3 Plus
Dper\GL17461-PA 118 GL17461-PA 1..105 19..125 315 70.6 Plus
Dper\GL11137-PA 93 GL11137-PA 17..91 58..142 243 55.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:40:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20768-PA 175 GA20768-PA 1..171 19..191 504 66.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:40:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20623-PA 180 GM20623-PA 1..179 19..197 843 94.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:40:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10097-PA 180 GD10097-PA 1..179 19..197 849 94.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:40:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18563-PA 183 GJ18563-PA 1..173 19..190 482 63.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:40:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22866-PA 175 GK22866-PA 1..171 19..188 480 64.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:40:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22489-PA 180 GE22489-PA 1..180 19..198 795 89.4 Plus

FI09344.hyp Sequence

Translation from 2 to 598

> FI09344.hyp
AYFSQHIVLARSINKTIIMSLVADYSDSSESDEDSSGQFSEDGETKSAAP
AKNEKTPPPKLPSASQAFSQGAGKGDVFNNPFLEAELHKTASLERHVKMV
DNDAHQKLKNGRKICWNFRRGRCRFGTSCQYAHDSDLSVDEAAEKSALPD
QSVPVVVEAAPGNFNRRKRPGLGDALEPGKRVMKSYKQQNPQNPFARR*

FI09344.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:47:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG42382-PA 180 CG8016-PA 1..180 19..198 947 100 Plus