Clone FI09833 Report

Search the DGRC for FI09833

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:98
Well:33
Vector:pOT2
Associated Gene/TranscriptMembrin-RA
Protein status:FI09833.pep: gold
Sequenced Size:842

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4780 2008-08-15 Release 5.9 accounting
CG4780 2008-12-18 5.12 accounting

Clone Sequence Records

FI09833.complete Sequence

842 bp assembled on 2008-07-28

GenBank Submission: BT044445.1

> FI09833.complete
TCCAATGTAAACGCGTCAGTTTTTTAAACAAACCAATTGCAACCGATTAA
ATATTAATTTGCGAATATTCTCGGGCCCATAAATTAATGCGGAATCAATA
GGGGAGAGCCATGGAGAGCCTGTACCACCAAACCAACAATGTGGTAAAGG
ACATCGAGCGCGATTTCCAGCGACTGAGTCAGCTCAGTGCCCAGGAATCG
CTTGACGTGGAAAACGGCATTCAATTGAAGATTACCCAGGCGAACGCCAA
CTGCGATCGGTTGGATGTGCTGCTGTATAAGGTGCCACCTTCGCAGCGAC
AAAGCTCCAAACTTCGTGTGGATCAGCTGAAATATGACCTGAGACACCTG
CAGACATCACTGCAGACGGCGCGGGAACGAAGACAGCGACGAATGCAGGA
GATCTCCGAGAGGGAACAGCTGCTGAATCACAGATTCACGGCAAACAGCG
CGCAGCCGGAGGAAACGCGCCTGCAATTGGACTACGAACTGCAGCATCAT
ACGCAGCTGGGTAACGCCCATCGGGGTGTGGATGACATGATTGCCTCGGG
CAGCGGCATTCTCGAGAGCCTGATCTCGCAGAGAATGACGCTGGGCGGAG
CGCACAAGAGAATCCAGGCGATAGGCAGCACACTGGGTCTGTCCAATCAC
ACGATGAAACTTATTGAACGCCGGCTGGTCGAAGATCGTCGGATATTCAT
CGGAGGAGTGGTGGTCACCTTGCTTATCATCGCCCTGATCATCTATTTCC
TAGTGCTCTAATCTGAAGACATCGCGTTTAGTTGAGTTTAAATTAAATGT
ACTCTATTTTGTAAAATGTTAAATAAAAAAAAAAAAAAAAAA

FI09833.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:02:58
Subject Length Description Subject Range Query Range Score Percent Strand
membrin-RA 879 membrin-RA 54..879 1..822 3840 98 Plus
CG10635-RA 772 CG10635-RA 553..772 824..605 1085 99.5 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:27:08
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 5359395..5359970 249..824 2820 99.3 Plus
chr3L 24539361 chr3L 5359076..5359324 1..247 1040 96.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:22:36 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:27:06
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 5366806..5367381 249..824 2820 99.3 Plus
3L 28110227 3L 5366485..5366735 1..247 1020 95.6 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:21:28
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 5359906..5360481 249..824 2820 99.3 Plus
3L 28103327 3L 5359585..5359835 1..247 1040 95.6 Plus
Blast to na_te.dros performed on 2019-03-15 17:27:06 has no hits.

FI09833.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:28:06 Download gff for FI09833.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 5359076..5359324 1..247 96 -> Plus
chr3L 5359394..5359970 248..824 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:01:02 Download gff for FI09833.complete
Subject Subject Range Query Range Percent Splice Strand
CG4780-RA 1..651 111..761 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:04:10 Download gff for FI09833.complete
Subject Subject Range Query Range Percent Splice Strand
membrin-RA 1..651 111..761 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:37:06 Download gff for FI09833.complete
Subject Subject Range Query Range Percent Splice Strand
membrin-RA 1..651 111..761 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:12 Download gff for FI09833.complete
Subject Subject Range Query Range Percent Splice Strand
CG4780-RA 1..651 111..761 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:38:23 Download gff for FI09833.complete
Subject Subject Range Query Range Percent Splice Strand
Membrin-RA 1..651 111..761 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:24:26 Download gff for FI09833.complete
Subject Subject Range Query Range Percent Splice Strand
CG4780-RA 1..826 1..822 98   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:04:09 Download gff for FI09833.complete
Subject Subject Range Query Range Percent Splice Strand
membrin-RA 1..826 1..822 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:37:06 Download gff for FI09833.complete
Subject Subject Range Query Range Percent Splice Strand
membrin-RA 31..858 1..824 98   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-28 11:45:09 Download gff for FI09833.complete
Subject Subject Range Query Range Percent Splice Strand
CG4780-RA 1..826 1..822 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:38:23 Download gff for FI09833.complete
Subject Subject Range Query Range Percent Splice Strand
Membrin-RA 31..858 1..824 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:28:06 Download gff for FI09833.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5366485..5366735 1..247 96 -> Plus
3L 5366805..5367381 248..824 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:28:06 Download gff for FI09833.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5366485..5366735 1..247 96 -> Plus
3L 5366805..5367381 248..824 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:28:06 Download gff for FI09833.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5366485..5366735 1..247 96 -> Plus
3L 5366805..5367381 248..824 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:37:06 Download gff for FI09833.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 5359585..5359835 1..247 96 -> Plus
arm_3L 5359905..5360481 248..824 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:32:28 Download gff for FI09833.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5359585..5359835 1..247 96 -> Plus
3L 5359905..5360481 248..824 99   Plus

FI09833.hyp Sequence

Translation from 110 to 760

> FI09833.hyp
MESLYHQTNNVVKDIERDFQRLSQLSAQESLDVENGIQLKITQANANCDR
LDVLLYKVPPSQRQSSKLRVDQLKYDLRHLQTSLQTARERRQRRMQEISE
REQLLNHRFTANSAQPEETRLQLDYELQHHTQLGNAHRGVDDMIASGSGI
LESLISQRMTLGGAHKRIQAIGSTLGLSNHTMKLIERRLVEDRRIFIGGV
VVTLLIIALIIYFLVL*

FI09833.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:49:10
Subject Length Description Subject Range Query Range Score Percent Strand
Membrin-PA 216 CG4780-PA 1..216 1..216 1073 100 Plus

FI09833.pep Sequence

Translation from 110 to 760

> FI09833.pep
MESLYHQTNNVVKDIERDFQRLSQLSAQESLDVENGIQLKITQANANCDR
LDVLLYKVPPSQRQSSKLRVDQLKYDLRHLQTSLQTARERRQRRMQEISE
REQLLNHRFTANSAQPEETRLQLDYELQHHTQLGNAHRGVDDMIASGSGI
LESLISQRMTLGGAHKRIQAIGSTLGLSNHTMKLIERRLVEDRRIFIGGV
VVTLLIIALIIYFLVL*

FI09833.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:17:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23976-PA 217 GF23976-PA 1..217 1..216 952 88.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:17:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15268-PA 216 GG15268-PA 1..216 1..216 1107 98.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:17:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16187-PA 215 GH16187-PA 1..214 1..216 882 81 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:33:41
Subject Length Description Subject Range Query Range Score Percent Strand
Membrin-PA 216 CG4780-PA 1..216 1..216 1073 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:17:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13338-PA 216 GI13338-PA 1..216 1..216 994 86.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:17:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12214-PA 216 GL12214-PA 1..216 1..216 1000 88 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:17:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18426-PA 216 GA18426-PA 1..216 1..216 1000 88 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:17:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14702-PA 216 GM14702-PA 1..216 1..216 1121 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:17:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13885-PA 216 GD13885-PA 1..216 1..216 1115 99.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:17:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13164-PA 216 GJ13164-PA 1..216 1..216 949 86.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:17:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16869-PA 220 GK16869-PA 1..220 1..215 926 82.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:17:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21490-PA 216 GE21490-PA 1..216 1..216 1105 98.6 Plus