Clone FI09903 Report

Search the DGRC for FI09903

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:99
Well:3
Vector:pOT2
Associated Gene/TranscriptCG1552-RA
Protein status:FI09903.pep: gold
Sequenced Size:867

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1552 2008-08-15 Release 5.9 accounting
CG1552 2008-12-18 5.12 accounting

Clone Sequence Records

FI09903.complete Sequence

867 bp assembled on 2008-07-28

GenBank Submission: BT044446.1

> FI09903.complete
CGCCAGCCGAGTCACCGAGATGTACCAGCTGGAGAAGATCTGGGTCCTGC
TGTGCCTGGCCCTCGTCGGTGTCCTTGGCTTCGGCCAGTTCCACATGAAG
CACTATCAGCTGCAGCGTAACTACAATACGCAGGAGGATTCCGGCGAGAA
TGACAATAGTGTGCTGCGAACCTTTCGCCGCTGCATGTGGGAGCAGTCGA
AGTTTCTGCCCCGCCGCCTCGTCCTTTTGAGCCTGTGCTCGAATCTCTTC
TGCGAGAACAATCACATAATGCCCCGTTCCAGGTCTATTTTCGTAGTGGA
AAAAATGTCTAGGCCGAATGACTGCCTGGACATCCTGCCCGAGCAATGCG
AGCAGGGCGATGAGGAGGAGCTGATGTACAAGCCCTTCCCCGACTGCTGT
CCGGTTTATTGCAACCTGAAGCGTCGGATGCAGCGCCTGCGCACCATGCA
CTTCCGGCACCGCCTGCTGCGCAACAAACAGGACGGCTCAGCGGGATCCG
CTGGCGGTGGATCCGCTGGTGGCGACGGTCCCAATAACTCGCTCCTCAGT
GAGTTTGTCTACAACAACTACTAGGATGACAGGATGGTTTTGCTCGGCAG
GATGGCCAACTAGGACGACGCGACGAGGACAATCCAGCAAATCAAATTAT
TCTGCGATTTGTGAACCAACCGGTCAAAATGGACAAAAAAGGAAGTCGCG
TCACCGCAACACTGAGCGGAAGTGGATCCAAAATCAAATTATTTGGATTG
TGTTAATCTCAATATGTATGTAGGCTATAATTTAGATTGTAACATATATA
AGCTGGTATTCATCAAACTGAGCACAAAAAAAAAAAAAAAAACACAAAAA
AAAAAAAAAAAAAAAAA

FI09903.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:03:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG1552-RA 1066 CG1552-RA 138..981 1..844 4205 99.8 Plus
CG1552-RB 1017 CG1552-RB 410..932 322..844 2600 99.8 Plus
CG1552-RB 1017 CG1552-RB 128..409 1..282 1410 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:31:22
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 10943608..10944126 844..322 2505 99 Minus
chrX 22417052 chrX 10944606..10944773 168..1 840 100 Minus
chrX 22417052 chrX 10944303..10944456 321..168 770 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:22:37 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:31:20
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11052335..11052857 844..322 2600 99.8 Minus
X 23542271 X 11053337..11053504 168..1 840 100 Minus
X 23542271 X 11053034..11053187 321..168 770 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:21:34
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 11060433..11060955 844..322 2600 99.8 Minus
X 23527363 X 11061435..11061602 168..1 840 100 Minus
X 23527363 X 11061132..11061285 321..168 770 100 Minus
Blast to na_te.dros performed on 2019-03-16 11:31:20 has no hits.

FI09903.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:32:04 Download gff for FI09903.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 10943627..10944126 322..825 99 <- Minus
chrX 10944303..10944456 168..321 100 <- Minus
chrX 10944607..10944773 1..167 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:01:05 Download gff for FI09903.complete
Subject Subject Range Query Range Percent Splice Strand
CG1552-RA 1..555 20..574 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:04:20 Download gff for FI09903.complete
Subject Subject Range Query Range Percent Splice Strand
CG1552-RA 1..555 20..574 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:00:03 Download gff for FI09903.complete
Subject Subject Range Query Range Percent Splice Strand
CG1552-RA 1..555 20..574 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:15 Download gff for FI09903.complete
Subject Subject Range Query Range Percent Splice Strand
CG1552-RA 1..555 20..574 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:20:05 Download gff for FI09903.complete
Subject Subject Range Query Range Percent Splice Strand
CG1552-RA 1..555 20..574 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:24:38 Download gff for FI09903.complete
Subject Subject Range Query Range Percent Splice Strand
CG1552-RA 13..837 1..825 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:04:20 Download gff for FI09903.complete
Subject Subject Range Query Range Percent Splice Strand
CG1552-RA 13..837 1..825 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:00:03 Download gff for FI09903.complete
Subject Subject Range Query Range Percent Splice Strand
CG1552-RA 13..837 1..825 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-28 11:45:23 Download gff for FI09903.complete
Subject Subject Range Query Range Percent Splice Strand
CG1552-RA 13..837 1..825 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:20:05 Download gff for FI09903.complete
Subject Subject Range Query Range Percent Splice Strand
CG1552-RC 53..877 1..825 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:32:04 Download gff for FI09903.complete
Subject Subject Range Query Range Percent Splice Strand
X 11052354..11052857 322..825 100 <- Minus
X 11053034..11053187 168..321 100 <- Minus
X 11053338..11053504 1..167 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:32:04 Download gff for FI09903.complete
Subject Subject Range Query Range Percent Splice Strand
X 11052354..11052857 322..825 100 <- Minus
X 11053034..11053187 168..321 100 <- Minus
X 11053338..11053504 1..167 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:32:04 Download gff for FI09903.complete
Subject Subject Range Query Range Percent Splice Strand
X 11052354..11052857 322..825 100 <- Minus
X 11053034..11053187 168..321 100 <- Minus
X 11053338..11053504 1..167 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:00:03 Download gff for FI09903.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 10946387..10946890 322..825 100 <- Minus
arm_X 10947067..10947220 168..321 100 <- Minus
arm_X 10947371..10947537 1..167 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:32:42 Download gff for FI09903.complete
Subject Subject Range Query Range Percent Splice Strand
X 11060452..11060955 322..825 100 <- Minus
X 11061132..11061285 168..321 100 <- Minus
X 11061436..11061602 1..167 100   Minus

FI09903.hyp Sequence

Translation from 1 to 573

> FI09903.hyp
ASRVTEMYQLEKIWVLLCLALVGVLGFGQFHMKHYQLQRNYNTQEDSGEN
DNSVLRTFRRCMWEQSKFLPRRLVLLSLCSNLFCENNHIMPRSRSIFVVE
KMSRPNDCLDILPEQCEQGDEEELMYKPFPDCCPVYCNLKRRMQRLRTMH
FRHRLLRNKQDGSAGSAGGGSAGGDGPNNSLLSEFVYNNY*

FI09903.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:49:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG1552-PC 184 CG1552-PC 1..184 7..190 1004 100 Plus
CG1552-PA 184 CG1552-PA 1..184 7..190 1004 100 Plus
CG1552-PB 171 CG1552-PB 1..171 7..190 910 92.4 Plus

FI09903.pep Sequence

Translation from 1 to 573

> FI09903.pep
ASRVTEMYQLEKIWVLLCLALVGVLGFGQFHMKHYQLQRNYNTQEDSGEN
DNSVLRTFRRCMWEQSKFLPRRLVLLSLCSNLFCENNHIMPRSRSIFVVE
KMSRPNDCLDILPEQCEQGDEEELMYKPFPDCCPVYCNLKRRMQRLRTMH
FRHRLLRNKQDGSAGSAGGGSAGGDGPNNSLLSEFVYNNY*

FI09903.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:18:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20400-PA 177 GF20400-PA 1..177 7..190 709 78.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:18:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18886-PA 171 GG18886-PA 1..171 7..190 882 91.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:18:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17597-PA 173 GH17597-PA 8..173 10..190 613 70.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:33:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG1552-PC 184 CG1552-PC 1..184 7..190 1004 100 Plus
CG1552-PA 184 CG1552-PA 1..184 7..190 1004 100 Plus
CG1552-PB 171 CG1552-PB 1..171 7..190 910 92.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:18:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16463-PA 167 GI16463-PA 22..167 26..190 593 73.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:18:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18316-PA 171 GL18316-PA 1..171 7..190 737 82.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:18:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27469-PA 90 GA27469-PA 8..90 108..190 335 86.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:18:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11269-PA 171 GM11269-PA 1..171 7..190 890 92.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:18:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24541-PA 101 GD24541-PA 1..101 7..107 534 99 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:18:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15942-PA 168 GJ15942-PA 12..167 15..188 565 68.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:18:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19897-PA 172 GK19897-PA 1..172 7..190 621 76.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:18:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17326-PA 171 GE17326-PA 1..171 7..190 885 91.8 Plus