Clone FI10917 Report

Search the DGRC for FI10917

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:109
Well:17
Vector:pOT2
Associated Gene/TranscriptCG5084-RA
Protein status:FI10917.pep: gold
Sequenced Size:797

Clone Sequence Records

FI10917.complete Sequence

797 bp assembled on 2009-02-03

GenBank Submission: BT058043.1

> FI10917.complete
AACATGCAGCTTTTCACACGAGTTATCCTGTTGGCCGTGACCATTTTCAG
CGTCAGTGCCGTGCCGCGTTTTGGAGAAGATATTGGTCTGGAGGAGGTCC
TATTCCGCATGGTCCTTGGTGAGGCTGAGGGTCGAGGTCTGACTCCTGCT
GCCCAGACTTGTGCCAACATCTACCTGAACACCACCCAGAAGAACGGCGA
TAAGTTGGCCAATGCCACCAATGCTTGCGAGGAGGCAGCCAATCGCACCA
ATGTCGCCTACACCCAGACCAGCAACTCCACCATCAACCAGATCCGTCTC
CAGTTGTTGACCCTGGAGCAGAACCTGCAGCTGTGCCGCAACGAGACCGA
TTCGGCTATTTTCCTGAACTGCACTGTGTCCACTTTCGACAAGAACCTCC
AGCTGCTGGACACCTCCAACTCGCAGGCCTACCGTGCTCAGTCCCAGTTC
GTTTCCAATGCCACTCAGATGAATGCCGAGAAATCGAACTGCATCAGCTC
CGCTGTTAGCGAGGCCAAGGTTCAGTCCATCCAGGCGGCCAACGACTTTA
ATTCGTGTCTGGACAAGATCCCAGCCCAGCGTGAGGTGCCACAAAAGATG
GAGCAGCAGCTGAGAGAGCAGCAGCAGGAGAAGCCCACCCAGATAACCAA
AGAGCAAGTGTCTGCGAAGCCACAGCTGATGTTCGAAGATCTGCCTTTGA
CCAACTAAGTTCAGAGATAAATAATTATTAAAATGCTTAACTTCACAGAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

FI10917.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:22:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG5084.a 1057 CG5084.a 308..1056 1..749 3745 100 Plus
CG5084-RA 862 CG5084-RA 49..797 1..749 3745 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:26:54
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 13906588..13906951 385..748 1730 98.4 Plus
chr2R 21145070 chr2R 13906195..13906527 52..384 1605 98.8 Plus
chr2R 21145070 chr2R 13905836..13905892 1..57 270 98.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:22:45 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:26:52
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18019439..18019803 385..749 1825 100 Plus
2R 25286936 2R 18019046..18019378 52..384 1665 100 Plus
2R 25286936 2R 18018690..18018746 1..57 270 98.2 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:39:33
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18020638..18021002 385..749 1825 100 Plus
2R 25260384 2R 18020245..18020577 52..384 1665 100 Plus
2R 25260384 2R 18019889..18019945 1..57 270 98.2 Plus
Blast to na_te.dros performed 2019-03-16 19:26:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2319..2387 589..657 110 65.7 Plus
roo 9092 roo DM_ROO 9092bp 1049..1123 584..657 110 65.8 Plus

FI10917.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:27:55 Download gff for FI10917.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 13905836..13905886 1..51 100 -> Plus
chr2R 13906195..13906527 52..384 98 -> Plus
chr2R 13906588..13906951 385..748 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:05:06 Download gff for FI10917.complete
Subject Subject Range Query Range Percent Splice Strand
CG5084-RA 1..705 4..708 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:33:36 Download gff for FI10917.complete
Subject Subject Range Query Range Percent Splice Strand
CG5084-RA 1..705 4..708 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:40:31 Download gff for FI10917.complete
Subject Subject Range Query Range Percent Splice Strand
CG5084-RA 1..705 4..708 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:32:04 Download gff for FI10917.complete
Subject Subject Range Query Range Percent Splice Strand
CG5084-RA 1..705 4..708 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-02-03 20:59:53 Download gff for FI10917.complete
Subject Subject Range Query Range Percent Splice Strand
CG5084-RA 49..756 1..708 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:33:36 Download gff for FI10917.complete
Subject Subject Range Query Range Percent Splice Strand
CG5084-RA 25..762 1..738 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:40:31 Download gff for FI10917.complete
Subject Subject Range Query Range Percent Splice Strand
CG5084-RA 26..763 1..738 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:32:04 Download gff for FI10917.complete
Subject Subject Range Query Range Percent Splice Strand
CG5084-RA 26..773 1..748 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:27:55 Download gff for FI10917.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18018690..18018740 1..51 100 -> Plus
2R 18019046..18019378 52..384 100 -> Plus
2R 18019439..18019802 385..748 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:27:55 Download gff for FI10917.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18018690..18018740 1..51 100 -> Plus
2R 18019046..18019378 52..384 100 -> Plus
2R 18019439..18019802 385..748 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:27:55 Download gff for FI10917.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18018690..18018740 1..51 100 -> Plus
2R 18019046..18019378 52..384 100 -> Plus
2R 18019439..18019802 385..748 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:40:31 Download gff for FI10917.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13906195..13906245 1..51 100 -> Plus
arm_2R 13906551..13906883 52..384 100 -> Plus
arm_2R 13906944..13907307 385..748 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:06:53 Download gff for FI10917.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18020245..18020577 52..384 100 -> Plus
2R 18020638..18021001 385..748 100   Plus
2R 18019889..18019939 1..51 100 -> Plus

FI10917.hyp Sequence

Translation from 0 to 707

> FI10917.hyp
NMQLFTRVILLAVTIFSVSAVPRFGEDIGLEEVLFRMVLGEAEGRGLTPA
AQTCANIYLNTTQKNGDKLANATNACEEAANRTNVAYTQTSNSTINQIRL
QLLTLEQNLQLCRNETDSAIFLNCTVSTFDKNLQLLDTSNSQAYRAQSQF
VSNATQMNAEKSNCISSAVSEAKVQSIQAANDFNSCLDKIPAQREVPQKM
EQQLREQQQEKPTQITKEQVSAKPQLMFEDLPLTN*

FI10917.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:49:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG5084-PB 234 CG5084-PB 1..234 2..235 1169 100 Plus
CG5084-PA 234 CG5084-PA 1..234 2..235 1169 100 Plus

FI10917.pep Sequence

Translation from 0 to 707

> FI10917.pep
NMQLFTRVILLAVTIFSVSAVPRFGEDIGLEEVLFRMVLGEAEGRGLTPA
AQTCANIYLNTTQKNGDKLANATNACEEAANRTNVAYTQTSNSTINQIRL
QLLTLEQNLQLCRNETDSAIFLNCTVSTFDKNLQLLDTSNSQAYRAQSQF
VSNATQMNAEKSNCISSAVSEAKVQSIQAANDFNSCLDKIPAQREVPQKM
EQQLREQQQEKPTQITKEQVSAKPQLMFEDLPLTN*

FI10917.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 10:59:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11685-PA 225 GF11685-PA 1..220 2..225 746 64.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 10:59:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21835-PA 231 GG21835-PA 1..231 2..235 1016 84.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 10:59:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21441-PA 240 GH21441-PA 1..216 2..211 484 47.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:23:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG5084-PB 234 CG5084-PB 1..234 2..235 1169 100 Plus
CG5084-PA 234 CG5084-PA 1..234 2..235 1169 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 10:59:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20244-PA 256 GI20244-PA 1..210 2..209 501 49.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 10:59:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11524-PA 134 GL11524-PA 1..127 2..128 449 68.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 10:59:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24758-PA 241 GA24758-PA 1..206 2..212 731 67.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 10:59:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21837-PA 234 GM21837-PA 1..234 2..235 1177 96.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 10:59:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11331-PA 234 GD11331-PA 1..234 2..235 1187 97 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 10:59:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20197-PA 243 GJ20197-PA 1..232 2..232 595 52.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 10:59:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22240-PA 231 GK22240-PA 1..198 2..203 488 55.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 10:59:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11913-PA 229 GE11913-PA 1..229 2..235 1080 89.7 Plus