Clone FI10923 Report

Search the DGRC for FI10923

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:109
Well:23
Vector:pOT2
Associated Gene/TranscriptCG31178-RB
Protein status:FI10923.pep: gold
Sequenced Size:1171

Clone Sequence Records

FI10923.complete Sequence

1171 bp assembled on 2009-02-03

GenBank Submission: BT058044.1

> FI10923.complete
CAAAGTTCAAAATTTTCGTCGAATGAAATTCCAAATTTGTTTCGTCTTCA
GTTTCCGGCAGACAAAGTCCTCATTTGGACACCGCCGACATCCCATCATC
GCATCTGATTACAGCAATCCCATACACGCTACAGCAGACTGCCTAATCCC
CTAGAGAACTGGTACTCGATATCCACAAAACTGATGATCATCGAACTTTG
CCTGGAATTTCACTTGATGTGGGAATTAAATGTTCGCATCTATTTTATGC
GAATGAGAGTGGCCATTGTTAATCAACTGGAGCCAATTGGGGACTTCTCC
TACTAGAATTATTCATAATATCGAGCAAATTAACTATCCAGGATCAGGGT
TAACTAGACGTCCATTTGTTCAGGAGCAAACTGGCCAAAATGTCTGGATC
GAGGCGACGCCGTACCGTTATGGGATACTACGAATACATAATGCCCGGGA
TTTATGAGTATCCTTTGATCCAATGTGATGCGAGTGCAATCCGTTCCTAT
AGTATTGACTCCATAATGACCAGTGCTTCATCAACTTGGTCAATTCCAGA
TAGCAATGCCGCCTATGTAGCTGGACCAATGGGCGTTATCCACTATCAAT
CGGATATGCAAACGCACTTGGCTCTGCCAACTAGGCAAAATCTGGAAACT
GGTCTTATATATCCAACCATTGAATCCAACTCATGTTTCCATGAGCCAAA
TCTAGAATATGTTCAAATGGAGAATGAGCACACCGATGACGACGAGGGAT
ACGGCTATGAAATTCCCGAGATTGTTCTCTGCTTAAACCGTTCAAATTCA
GAGTCCGGCGCAGCTGAGGAATCTGGCGATTCGCAGCGTTCGTCAAAGAG
TTATTCATCGGTGGAGATTAGCGAGCAGTCAAGATCGGGGGAATACGTTA
AATTAGAATCGGTTTTCAGGAGGCGAAGAAAAGTATCGCAGAAGCGCAAA
TATACCACCGAGCAGGGTTACCTGGTTGAGGAACCCACCAGCGAACCATC
TGAGGAGGATGCCGAGGAACAGGCACCAAAATCCAGAAAATAGATATCTC
ATATTTCAGTTCAGCATCTACGTTTGACTATAGAAAAAAAACGTTACCCT
CTTTGATTTTTCGTTGGAATTTGTAGTGATCAAAATATATATATTTTATA
AATAAAAAAAAAAAAAAAAAA

FI10923.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:22:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG31178-RB 1184 CG31178-RB 31..1184 1..1153 5730 99.9 Plus
CG31178-RA 1118 CG31178-RA 515..1118 550..1153 3020 100 Plus
CG31178-RA 1118 CG31178-RA 31..514 1..483 2380 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:08:12
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 17697484..17698637 1..1153 5690 99.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:22:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:08:10
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21873769..21874923 1..1154 5725 99.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:39:45
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 21614600..21615754 1..1154 5735 99.9 Plus
Blast to na_te.dros performed 2019-03-16 21:08:11
Subject Length Description Subject Range Query Range Score Percent Strand
mdg1 7480 mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). 6803..6920 1028..1149 114 58.5 Plus

FI10923.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:09:07 Download gff for FI10923.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 17697484..17698612 1..1128 99 <- Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:05:07 Download gff for FI10923.complete
Subject Subject Range Query Range Percent Splice Strand
CG31178-RB 1..654 390..1043 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:33:57 Download gff for FI10923.complete
Subject Subject Range Query Range Percent Splice Strand
CG31178-RB 1..654 390..1043 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:47:34 Download gff for FI10923.complete
Subject Subject Range Query Range Percent Splice Strand
CG31178-RB 1..654 390..1043 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:07:17 Download gff for FI10923.complete
Subject Subject Range Query Range Percent Splice Strand
CG31178-RB 1..654 390..1043 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-02-03 20:59:59 Download gff for FI10923.complete
Subject Subject Range Query Range Percent Splice Strand
CG31178-RB 31..1184 1..1153 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:33:57 Download gff for FI10923.complete
Subject Subject Range Query Range Percent Splice Strand
CG31178-RB 31..1184 1..1153 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:47:34 Download gff for FI10923.complete
Subject Subject Range Query Range Percent Splice Strand
CG31178-RB 31..1184 1..1153 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:07:17 Download gff for FI10923.complete
Subject Subject Range Query Range Percent Splice Strand
CG31178-RB 31..1184 1..1153 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:09:07 Download gff for FI10923.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21873769..21874922 1..1153 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:09:07 Download gff for FI10923.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21873769..21874922 1..1153 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:09:07 Download gff for FI10923.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21873769..21874922 1..1153 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:47:34 Download gff for FI10923.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 17699491..17700644 1..1153 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:07:16 Download gff for FI10923.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21614600..21615753 1..1153 99   Plus

FI10923.pep Sequence

Translation from 389 to 1042

> FI10923.pep
MSGSRRRRTVMGYYEYIMPGIYEYPLIQCDASAIRSYSIDSIMTSASSTW
SIPDSNAAYVAGPMGVIHYQSDMQTHLALPTRQNLETGLIYPTIESNSCF
HEPNLEYVQMENEHTDDDEGYGYEIPEIVLCLNRSNSESGAAEESGDSQR
SSKSYSSVEISEQSRSGEYVKLESVFRRRRKVSQKRKYTTEQGYLVEEPT
SEPSEEDAEEQAPKSRK*

FI10923.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 10:59:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16958-PA 254 GF16958-PA 15..252 6..214 332 36.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 10:59:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11087-PA 195 GG11087-PA 1..192 1..213 690 68.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:11:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG31178-PB 217 CG31178-PB 1..217 1..217 1123 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 10:59:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23799-PA 210 GL23799-PA 12..191 16..200 174 30.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 10:59:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16068-PA 210 GA16068-PA 12..199 16..210 185 32.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 10:59:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26380-PA 217 GM26380-PA 1..217 1..217 901 89.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 10:59:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20903-PA 195 GD20903-PA 1..195 1..217 702 80.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 10:59:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10247-PA 197 GE10247-PA 1..197 1..217 664 64.8 Plus

FI10923.hyp Sequence

Translation from 389 to 1042

> FI10923.hyp
MSGSRRRRTVMGYYEYIMPGIYEYPLIQCDASAIRSYSIDSIMTSASSTW
SIPDSNAAYVAGPMGVIHYQSDMQTHLALPTRQNLETGLIYPTIESNSCF
HEPNLEYVQMENEHTDDDEGYGYEIPEIVLCLNRSNSESGAAEESGDSQR
SSKSYSSVEISEQSRSGEYVKLESVFRRRRKVSQKRKYTTEQGYLVEEPT
SEPSEEDAEEQAPKSRK*

FI10923.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:49:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG31178-PB 217 CG31178-PB 1..217 1..217 1123 100 Plus