Clone FI10950 Report

Search the DGRC for FI10950

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:109
Well:50
Vector:pOT2
Associated Gene/Transcriptatilla-RB
Protein status:FI10950.pep: gold
Sequenced Size:860

Clone Sequence Records

FI10950.complete Sequence

860 bp assembled on 2009-02-03

GenBank Submission: BT058046.1

> FI10950.complete
ATCAAAACAAAATAGTTTTTTTTTTAGTGACCCCAATGCGTGGATCGCCA
AATTGACATAACAAACACATAACTCGTTCCGAGTTTCACTCAACTAATGC
CAGTTTCTTGAGTGAATGAGCAGAGCTTTTCACGCTGATCGCCACTCGAA
AACAAGTTGCGAATGTGGAGCGTGCTGAAAACAAACCCGAAACTAATTTC
AGTTGTTCAGCGTCTGCCAAACGGTTCAAACCGAAAACGATTTGAATACA
TTTTCCAAATATTAAAGTTTGTTCAAAACCCACCAAATATGCTGAAACAA
GTGATTTTCGTGCTCCTCATCGCCGTGTGCACAATGCACAGTGCATCGGC
CATCAAGTGTTATCAGTGCAAATCCCTCACGGATCCCAACTGCGCCAAGG
ACAAGATCGATTCTGCCTCTAACATCCGCGCCGTGGATTGCGACAGTGTG
CCCAAGCCCAACACCATGGAGCAACTGCAGCCAGTGACCAGGTGCAACAA
GGTGGTCACCAGCGACCGCGCTGGAACGATTGTGTCCCGCGACTGCCACT
TCGAGTCCATCGGGCAGAAGGACAACGAATGCACGGTGACCCACAGCCGG
CAGGTGGAGAGCTGCTACACCTGCAAGGGTGACCTGTGCAACGCATCCGG
AGCAGGCCGCTTTGTGGCGGTCAGTGCAACGGCTCTCCTGGCGATCCTCG
CCCTCAACTTGAGCCTGTGATGCCGCACCAAATCCGGTCCAGAAATGCAT
TAAATAAGTGTGAAAAACATACCTGTACAAAGGAGAAATGTAAATGTTAA
CTATAATATTGATCAAAATAAAGTAAATCAAACTAAAAAAAAAAAAAAAA
AAAAAAAAAA

FI10950.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:22:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG6579-RB 899 CG6579-RB 1..837 1..837 4185 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:51:50
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 12176205..12176547 343..1 1715 100 Minus
chr2L 23010047 chr2L 12174105..12174425 834..514 1605 100 Minus
chr2L 23010047 chr2L 12175465..12175636 514..343 860 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:22:50 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:51:47
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 12177544..12177886 343..1 1715 100 Minus
2L 23513712 2L 12175448..12175771 837..514 1620 100 Minus
2L 23513712 2L 12176804..12176975 514..343 860 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:39:46
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 12177544..12177886 343..1 1715 100 Minus
2L 23513712 2L 12175448..12175771 837..514 1620 100 Minus
2L 23513712 2L 12176804..12176975 514..343 860 100 Minus
Blast to na_te.dros performed 2019-03-16 06:51:48
Subject Length Description Subject Range Query Range Score Percent Strand
Quasimodo 7387 Quasimodo QUASIMODO 7387bp Derived from P1 clones DS08479 & DS07153 by Sue Celniker, 29 March 2001. 6068..6114 786..833 129 77.1 Plus

FI10950.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:53:04 Download gff for FI10950.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 12174105..12174424 515..834 100 <- Minus
chr2L 12175465..12175635 344..514 100 <- Minus
chr2L 12176205..12176547 1..343 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:05:07 Download gff for FI10950.complete
Subject Subject Range Query Range Percent Splice Strand
CG6579-RB 1..432 289..720 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:33:59 Download gff for FI10950.complete
Subject Subject Range Query Range Percent Splice Strand
CG6579-RB 1..432 289..720 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:52:25 Download gff for FI10950.complete
Subject Subject Range Query Range Percent Splice Strand
atilla-RB 1..432 289..720 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:24:22 Download gff for FI10950.complete
Subject Subject Range Query Range Percent Splice Strand
atilla-RB 1..432 289..720 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-02-03 21:34:01 Download gff for FI10950.complete
Subject Subject Range Query Range Percent Splice Strand
CG6579-RB 1..834 1..834 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:33:59 Download gff for FI10950.complete
Subject Subject Range Query Range Percent Splice Strand
CG6579-RB 1..834 1..834 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:52:25 Download gff for FI10950.complete
Subject Subject Range Query Range Percent Splice Strand
atilla-RB 1..834 1..834 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:24:22 Download gff for FI10950.complete
Subject Subject Range Query Range Percent Splice Strand
atilla-RB 1..834 1..834 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:53:04 Download gff for FI10950.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12175451..12175770 515..834 100 <- Minus
2L 12176804..12176974 344..514 100 <- Minus
2L 12177544..12177886 1..343 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:53:04 Download gff for FI10950.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12175451..12175770 515..834 100 <- Minus
2L 12176804..12176974 344..514 100 <- Minus
2L 12177544..12177886 1..343 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:53:04 Download gff for FI10950.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12175451..12175770 515..834 100 <- Minus
2L 12176804..12176974 344..514 100 <- Minus
2L 12177544..12177886 1..343 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:52:25 Download gff for FI10950.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 12175451..12175770 515..834 100 <- Minus
arm_2L 12176804..12176974 344..514 100 <- Minus
arm_2L 12177544..12177886 1..343 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:07:17 Download gff for FI10950.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12175451..12175770 515..834 100 <- Minus
2L 12176804..12176974 344..514 100 <- Minus
2L 12177544..12177886 1..343 100   Minus

FI10950.hyp Sequence

Translation from 162 to 719

> FI10950.hyp
MWSVLKTNPKLISVVQRLPNGSNRKRFEYIFQILKFVQNPPNMLKQVIFV
LLIAVCTMHSASAIKCYQCKSLTDPNCAKDKIDSASNIRAVDCDSVPKPN
TMEQLQPVTRCNKVVTSDRAGTIVSRDCHFESIGQKDNECTVTHSRQVES
CYTCKGDLCNASGAGRFVAVSATALLAILALNLSL*

FI10950.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:49:49
Subject Length Description Subject Range Query Range Score Percent Strand
atilla-PC 143 CG6579-PC 1..143 43..185 743 100 Plus
atilla-PB 143 CG6579-PB 1..143 43..185 743 100 Plus

FI10950.pep Sequence

Translation from 162 to 719

> FI10950.pep
MWSVLKTNPKLISVVQRLPNGSNRKRFEYIFQILKFVQNPPNMLKQVIFV
LLIAVCTMHSASAIKCYQCKSLTDPNCAKDKIDSASNIRAVDCDSVPKPN
TMEQLQPVTRCNKVVTSDRAGTIVSRDCHFESIGQKDNECTVTHSRQVES
CYTCKGDLCNASGAGRFVAVSATALLAILALNLSL*

FI10950.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 10:59:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15677-PA 143 GF15677-PA 1..143 43..185 649 85.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 10:59:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10268-PA 143 GG10268-PA 1..143 43..185 627 88.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 10:59:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10139-PA 143 GH10139-PA 1..143 43..185 623 77.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:57:05
Subject Length Description Subject Range Query Range Score Percent Strand
atilla-PC 143 CG6579-PC 1..143 43..185 743 100 Plus
atilla-PB 143 CG6579-PB 1..143 43..185 743 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 10:59:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22236-PA 143 GI22236-PA 1..130 43..172 581 81.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 10:59:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19509-PA 143 GL19509-PA 1..143 43..185 629 79 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 10:59:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19698-PA 180 GA19698-PA 57..180 62..185 565 81.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 10:59:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26273-PA 143 GM26273-PA 1..143 43..185 734 96.5 Plus
Dsec\GM23382-PA 141 GM23382-PA 7..122 50..164 137 34.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 10:59:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22125-PA 184 GD22125-PA 1..137 43..179 716 97.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 10:59:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20134-PA 143 GJ20134-PA 1..143 43..185 587 79 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 10:59:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14632-PA 148 GK14632-PA 1..144 43..182 495 72.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 10:59:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12358-PA 143 GE12358-PA 1..143 43..185 649 92.3 Plus