Clone FI11301 Report

Search the DGRC for FI11301

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:113
Well:1
Vector:pOT2
Associated Gene/TranscriptCG7968-RA
Protein status:FI11301.pep: gold
Sequenced Size:874

Clone Sequence Records

FI11301.complete Sequence

874 bp assembled on 2009-05-27

GenBank Submission: BT088439.1

> FI11301.complete
CTCGCGATGAGAACTTCTTGTGTAATTTTTGTGGCCCTTCTGTGCTGCTC
CTTGGGCTCCGCCAAGCTCTTCGATGATGAGCTGCGCGAACTGACGGAGT
TCCTGCGTTTGCAGATGCGATGTGGCTACCCGGCCAGAGGGGTTCCCATT
TTGGCCCCGGCTCAGATGGCCTACAAGGAAATTGGCATCAGAACTGAGAA
CTTTGGTTGCAATGGAAACTTCACCGATCTGATTATCGAGGGATTGGATG
GGTACGAGTTCTCCAAGCTGGAGTGGAACAACATTTTGCATACCATTAAG
TTCGACATGAACTTCCCCAAGATTTCCCTGAAGAGCACAAACTATAAACT
AAATCTCCTGGCTCGTCTATTTGGTGCCGATTTCTCCCTGTGGGGTGACG
GTGCCCTCAGTCTGGAGTTGATCAATTTCCGAGCTTACGGCAGTTTCGTT
ATTCGCCCAAAGTCGGCCACCAGTGGTGTGTACGCCAAGAGCTGGAAGGT
TAACTGGGAATTGGAGGAGGCTAAGTCCCAGACCACGGGCTTTATGAACA
GTCGTCTGTACACGAAGTTCATCAACGATCTGATCGTGGAGTATCTCGAT
ATCATGATCAATGACAACCCCACGGAAGTTTCCCAATTCATGGAGGAGCT
CATTGTTCCGCCCATGAATTTGGTTCTGGATAATCTGGCCTGGTATGAGA
TTACCGCTATCATTTTGGGCCTGGCCGAGGGAATTTTGCCGGTGGAGCCA
ATTTGCTGAAGTGCTGACAAAAACGATTGCCAGGTGTTCCCTGTGCTTAA
ATGTAAAAATAATCATTAATAATCATTTGATAAGAAATTAAAAGGAACTA
CTTGTAAAAAAAAAAAAAAAAAAA

FI11301.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:31:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG7968-RA 864 CG7968-RA 9..864 1..856 4280 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:37:20
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 13848410..13849059 206..855 3235 99.8 Plus
chr2L 23010047 chr2L 13848142..13848347 1..206 1030 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:23:01 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:37:18
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13849680..13850330 206..856 3255 100 Plus
2L 23513712 2L 13849412..13849617 1..206 1030 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:47:34
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13849680..13850330 206..856 3255 100 Plus
2L 23513712 2L 13849412..13849617 1..206 1030 100 Plus
Blast to na_te.dros performed on 2019-03-16 10:37:19 has no hits.

FI11301.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:38:01 Download gff for FI11301.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 13848142..13848347 1..206 100 -> Plus
chr2L 13848411..13849059 207..855 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:09:41 Download gff for FI11301.complete
Subject Subject Range Query Range Percent Splice Strand
CG7968-RA 1..753 7..759 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:46:35 Download gff for FI11301.complete
Subject Subject Range Query Range Percent Splice Strand
CG7968-RA 1..753 7..759 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:43:58 Download gff for FI11301.complete
Subject Subject Range Query Range Percent Splice Strand
CG7968-RA 1..753 7..759 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:13:24 Download gff for FI11301.complete
Subject Subject Range Query Range Percent Splice Strand
CG7968-RA 1..753 7..759 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-27 11:44:50 Download gff for FI11301.complete
Subject Subject Range Query Range Percent Splice Strand
CG7968-RA 1..853 1..853 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:46:34 Download gff for FI11301.complete
Subject Subject Range Query Range Percent Splice Strand
CG7968-RA 1..853 1..853 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:43:58 Download gff for FI11301.complete
Subject Subject Range Query Range Percent Splice Strand
CG7968-RA 13..867 1..855 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:13:24 Download gff for FI11301.complete
Subject Subject Range Query Range Percent Splice Strand
CG7968-RA 13..867 1..855 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:38:01 Download gff for FI11301.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13849412..13849617 1..206 100 -> Plus
2L 13849681..13850329 207..855 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:38:01 Download gff for FI11301.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13849412..13849617 1..206 100 -> Plus
2L 13849681..13850329 207..855 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:38:01 Download gff for FI11301.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13849412..13849617 1..206 100 -> Plus
2L 13849681..13850329 207..855 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:43:58 Download gff for FI11301.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 13849412..13849617 1..206 100 -> Plus
arm_2L 13849681..13850329 207..855 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:21:56 Download gff for FI11301.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13849412..13849617 1..206 100 -> Plus
2L 13849681..13850329 207..855 100   Plus

FI11301.pep Sequence

Translation from 0 to 758

> FI11301.pep
LAMRTSCVIFVALLCCSLGSAKLFDDELRELTEFLRLQMRCGYPARGVPI
LAPAQMAYKEIGIRTENFGCNGNFTDLIIEGLDGYEFSKLEWNNILHTIK
FDMNFPKISLKSTNYKLNLLARLFGADFSLWGDGALSLELINFRAYGSFV
IRPKSATSGVYAKSWKVNWELEEAKSQTTGFMNSRLYTKFINDLIVEYLD
IMINDNPTEVSQFMEELIVPPMNLVLDNLAWYEITAIILGLAEGILPVEP
IC*

FI11301.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:29:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14266-PA 250 GF14266-PA 1..250 3..252 1087 77.6 Plus
Dana\GF14265-PA 296 GF14265-PA 57..285 27..252 224 26.2 Plus
Dana\GF15613-PA 259 GF15613-PA 34..239 30..236 213 23.2 Plus
Dana\GF15614-PA 242 GF15614-PA 40..241 31..240 211 26.7 Plus
Dana\GF14264-PA 287 GF14264-PA 1..257 3..234 160 26.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:29:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23893-PA 250 GG23893-PA 1..250 3..252 1274 96.4 Plus
Dere\GG23892-PA 297 GG23892-PA 58..286 27..252 228 27.9 Plus
Dere\GG10175-PA 261 GG10175-PA 37..237 33..234 205 23.3 Plus
Dere\GG10176-PA 244 GG10176-PA 41..242 33..240 169 23.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:29:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11123-PA 245 GH11123-PA 1..245 3..252 850 61.4 Plus
Dgri\GH10611-PA 258 GH10611-PA 34..239 30..236 230 23.2 Plus
Dgri\GH11122-PA 301 GH11122-PA 62..290 27..252 228 27.5 Plus
Dgri\GH10612-PA 250 GH10612-PA 41..227 33..223 188 25.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:17:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG7968-PA 250 CG7968-PA 1..250 3..252 1307 100 Plus
CG7953-PB 297 CG7953-PB 58..285 27..251 221 27.2 Plus
CG7953-PA 297 CG7953-PA 58..285 27..251 221 27.2 Plus
CG8997-PB 260 CG8997-PB 3..247 9..244 209 23.2 Plus
CG8997-PA 260 CG8997-PA 3..247 9..244 209 23.2 Plus
CG33306-PA 244 CG33306-PA 41..242 33..240 171 22.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:29:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12614-PA 249 GI12614-PA 1..249 3..252 769 57 Plus
Dmoj\GI12604-PA 298 GI12604-PA 59..287 27..252 232 27.9 Plus
Dmoj\GI17402-PA 256 GI17402-PA 34..244 30..244 214 23.3 Plus
Dmoj\GI17403-PA 245 GI17403-PA 41..244 33..240 205 24.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:29:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21242-PA 250 GL21242-PA 1..250 3..252 1085 74.8 Plus
Dper\GL21241-PA 297 GL21241-PA 58..286 27..252 230 27.5 Plus
Dper\GL21075-PA 258 GL21075-PA 32..239 28..236 208 23 Plus
Dper\GL21076-PA 245 GL21076-PA 3..242 6..240 203 24.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:29:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20729-PA 250 GA20729-PA 1..250 3..252 1095 75.6 Plus
Dpse\GA20716-PA 297 GA20716-PA 58..286 27..252 231 27.5 Plus
Dpse\GA21464-PA 258 GA21464-PA 32..239 28..236 207 23 Plus
Dpse\GA29061-PA 245 GA29061-PA 3..242 6..240 203 24.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:29:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15330-PA 250 GM15330-PA 1..250 3..252 1301 98 Plus
Dsec\GM15320-PA 297 GM15320-PA 58..286 27..252 218 27.1 Plus
Dsec\GM15045-PA 258 GM15045-PA 34..239 30..236 211 23.2 Plus
Dsec\GM15048-PA 242 GM15048-PA 39..240 33..240 163 21.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:29:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23934-PA 250 GD23934-PA 1..250 3..252 1287 97.6 Plus
Dsim\GD23933-PA 289 GD23933-PA 58..278 27..252 209 27.8 Plus
Dsim\GD22033-PA 244 GD22033-PA 41..242 33..240 167 22.1 Plus
Dsim\GD23932-PA 287 GD23932-PA 1..259 3..232 159 25 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:29:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18153-PA 251 GJ18153-PA 1..251 3..252 874 62.9 Plus
Dvir\GJ18152-PA 301 GJ18152-PA 62..290 27..252 230 28.4 Plus
Dvir\GJ18080-PA 256 GJ18080-PA 34..240 30..240 212 23.2 Plus
Dvir\GJ18082-PA 250 GJ18082-PA 35..250 24..243 189 23.2 Plus
Dvir\GJ18083-PA 247 GJ18083-PA 41..244 33..240 171 23.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:29:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15017-PA 253 GK15017-PA 1..253 3..252 980 70.4 Plus
Dwil\GK15016-PA 298 GK15016-PA 59..287 27..252 227 27.9 Plus
Dwil\GK15117-PA 242 GK15117-PA 40..242 33..241 211 26.1 Plus
Dwil\GK15116-PA 258 GK15116-PA 34..237 30..234 196 22 Plus
Dwil\GK12165-PA 254 GK12165-PA 22..247 17..243 153 21.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:29:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18692-PA 250 GE18692-PA 1..250 3..252 1276 96.4 Plus
Dyak\GE18691-PA 297 GE18691-PA 58..286 27..252 227 27.5 Plus
Dyak\GE11368-PA 259 GE11368-PA 34..237 30..234 217 23.9 Plus
Dyak\GE11373-PA 244 GE11373-PA 41..242 33..240 162 22.1 Plus
Dyak\GE18690-PA 287 GE18690-PA 60..259 38..232 158 27.4 Plus

FI11301.hyp Sequence

Translation from 0 to 758

> FI11301.hyp
LAMRTSCVIFVALLCCSLGSAKLFDDELRELTEFLRLQMRCGYPARGVPI
LAPAQMAYKEIGIRTENFGCNGNFTDLIIEGLDGYEFSKLEWNNILHTIK
FDMNFPKISLKSTNYKLNLLARLFGADFSLWGDGALSLELINFRAYGSFV
IRPKSATSGVYAKSWKVNWELEEAKSQTTGFMNSRLYTKFINDLIVEYLD
IMINDNPTEVSQFMEELIVPPMNLVLDNLAWYEITAIILGLAEGILPVEP
IC*

FI11301.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:50:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG7968-PA 250 CG7968-PA 1..250 3..252 1307 100 Plus
CG7953-PB 297 CG7953-PB 58..285 27..251 221 27.2 Plus
CG7953-PA 297 CG7953-PA 58..285 27..251 221 27.2 Plus
CG8997-PB 260 CG8997-PB 3..247 9..244 209 23.2 Plus
CG8997-PA 260 CG8997-PA 3..247 9..244 209 23.2 Plus