Clone FI11929 Report

Search the DGRC for FI11929

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:119
Well:29
Vector:pFlc-1
Associated Gene/TranscriptSrp14-RB
Protein status:FI11929.pep: gold
Sequenced Size:461

Clone Sequence Records

FI11929.complete Sequence

461 bp assembled on 2009-08-27

GenBank Submission: BT099652.1

> FI11929.complete
ACTTTTCCCGTTTCTCCTGTTTTATTTGCCACGAAATGGTTTTGCTAGAC
AATTCGAACTTTATCCTGCGCCTGGAGAAGATCGCAAATGCGGCCAAGAA
GGACTCCTCCTTCACGCTGACGTTCAAGCGATATGATGGCAACGATAAGC
CCGTGCCGAGGGAAGGACGGCCACCGCTGCCCAAGCCGGAGACCTACATG
TGCCTGATGCGCGCCCAGTCCAAGTCCCAAAAAATTTCCACCGTTGTCCG
GCAGGAGGATGTGCCCGCCATGATGAGCATGTACTCGCAGTTCATGAAGA
GCAAGATGGACGGGCTAAAGCGGGTTAAGAAAGTCAAAAGCAAGGCCAAG
GCGACAAAGGGTTAATCGGGGCATAGTCTTAGTTAGATTTTATTTGACTG
TTTACTGGTCGTTTGTTTTAAACCTTAAATGCATCATTTTGTACGAAAAA
AAAAAAAAAAA

FI11929.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:33:44
Subject Length Description Subject Range Query Range Score Percent Strand
Srp14-RB 621 Srp14-RB 137..585 1..449 2230 99.7 Plus
Srp14-RC 689 Srp14-RC 337..653 133..449 1570 99.6 Plus
Srp14-RC 689 Srp14-RC 137..272 1..136 665 99.2 Plus
CG34008-RA 851 CG34008-RA 745..851 449..343 520 99 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:09:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 16404467..16404678 234..445 1060 100 Plus
chr3R 27901430 chr3R 16404304..16404404 133..233 505 100 Plus
chr3R 27901430 chr3R 16404163..16404239 60..136 370 98.7 Plus
chr3R 27901430 chr3R 16404048..16404106 1..59 295 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:23:16 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:09:01
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 20580553..20580768 234..449 1065 99.5 Plus
3R 32079331 3R 20580390..20580490 133..233 505 100 Plus
3R 32079331 3R 20580249..20580325 60..136 370 98.7 Plus
3R 32079331 3R 20580134..20580192 1..59 295 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:50:43
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 20321384..20321599 234..449 1065 99.5 Plus
3R 31820162 3R 20321221..20321321 133..233 505 100 Plus
3R 31820162 3R 20321080..20321156 60..136 370 98.7 Plus
3R 31820162 3R 20320965..20321023 1..59 295 100 Plus
Blast to na_te.dros performed on 2019-03-15 15:09:01 has no hits.

FI11929.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:10:04 Download gff for FI11929.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 16404048..16404106 1..59 100 -> Plus
chr3R 16404163..16404235 60..132 100 -> Plus
chr3R 16404304..16404404 133..233 100 -> Plus
chr3R 16404467..16404678 234..445 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:14:52 Download gff for FI11929.complete
Subject Subject Range Query Range Percent Splice Strand
Srp14-RB 1..330 36..365 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:51:44 Download gff for FI11929.complete
Subject Subject Range Query Range Percent Splice Strand
Srp14-RB 1..330 36..365 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:04:35 Download gff for FI11929.complete
Subject Subject Range Query Range Percent Splice Strand
Srp14-RB 1..330 36..365 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:28:51 Download gff for FI11929.complete
Subject Subject Range Query Range Percent Splice Strand
Srp14-RB 1..330 36..365 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-08-27 16:54:31 Download gff for FI11929.complete
Subject Subject Range Query Range Percent Splice Strand
Srp14-RB 7..446 1..440 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:51:44 Download gff for FI11929.complete
Subject Subject Range Query Range Percent Splice Strand
Srp14-RB 11..455 1..445 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:04:35 Download gff for FI11929.complete
Subject Subject Range Query Range Percent Splice Strand
Srp14-RB 20..464 1..445 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:28:51 Download gff for FI11929.complete
Subject Subject Range Query Range Percent Splice Strand
Srp14-RB 20..464 1..445 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:10:04 Download gff for FI11929.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20580249..20580321 60..132 100 -> Plus
3R 20580390..20580490 133..233 100 -> Plus
3R 20580553..20580764 234..445 100   Plus
3R 20580134..20580192 1..59 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:10:04 Download gff for FI11929.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20580249..20580321 60..132 100 -> Plus
3R 20580390..20580490 133..233 100 -> Plus
3R 20580553..20580764 234..445 100   Plus
3R 20580134..20580192 1..59 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:10:04 Download gff for FI11929.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20580249..20580321 60..132 100 -> Plus
3R 20580390..20580490 133..233 100 -> Plus
3R 20580553..20580764 234..445 100   Plus
3R 20580134..20580192 1..59 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:04:35 Download gff for FI11929.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 16405856..16405914 1..59 100 -> Plus
arm_3R 16405971..16406043 60..132 100 -> Plus
arm_3R 16406112..16406212 133..233 100 -> Plus
arm_3R 16406275..16406486 234..445 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:27:50 Download gff for FI11929.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20321384..20321595 234..445 100   Plus
3R 20320965..20321023 1..59 100 -> Plus
3R 20321080..20321152 60..132 100 -> Plus
3R 20321221..20321321 133..233 100 -> Plus

FI11929.pep Sequence

Translation from 2 to 364

> FI11929.pep
FSRFSCFICHEMVLLDNSNFILRLEKIANAAKKDSSFTLTFKRYDGNDKP
VPREGRPPLPKPETYMCLMRAQSKSQKISTVVRQEDVPAMMSMYSQFMKS
KMDGLKRVKKVKSKAKATKG*

FI11929.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:43:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16681-PA 109 GF16681-PA 1..94 12..105 458 90.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:43:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23978-PA 109 GG23978-PA 1..94 12..105 473 94.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:43:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17169-PA 109 GH17169-PA 1..94 12..105 417 84 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:12:45
Subject Length Description Subject Range Query Range Score Percent Strand
Srp14-PB 109 CG5417-PB 1..109 12..120 552 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:43:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10582-PA 109 GI10582-PA 1..96 12..107 456 87.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:43:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13565-PA 109 GL13565-PA 1..94 12..105 454 90.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:43:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18867-PA 109 GA18867-PA 1..94 12..105 454 90.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:43:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23120-PA 109 GM23120-PA 1..109 12..120 558 98.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:43:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19359-PA 199 GD19359-PA 80..199 1..120 630 98.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:43:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22939-PA 109 GJ22939-PA 1..94 12..105 416 84 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:43:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22455-PA 109 GK22455-PA 1..94 12..105 462 91.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:43:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25671-PA 122 GE25671-PA 3..122 1..120 618 97.5 Plus

FI11929.hyp Sequence

Translation from 2 to 364

> FI11929.hyp
FSRFSCFICHEMVLLDNSNFILRLEKIANAAKKDSSFTLTFKRYDGNDKP
VPREGRPPLPKPETYMCLMRAQSKSQKISTVVRQEDVPAMMSMYSQFMKS
KMDGLKRVKKVKSKAKATKG*

FI11929.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:51:25
Subject Length Description Subject Range Query Range Score Percent Strand
Srp14-PB 109 CG5417-PB 1..109 12..120 552 100 Plus