BDGP Sequence Production Resources |
Search the DGRC for FI11929
Library: | FI |
Tissue Source: | various Drosophila melanogaster |
Created by: | |
Date Registered: | 2005-11-08 |
Comments: | Drosophila melanogaster corrected cDNA clones |
Original Plate Number: | 119 |
Well: | 29 |
Vector: | pFlc-1 |
Associated Gene/Transcript | Srp14-RB |
Protein status: | FI11929.pep: gold |
Sequenced Size: | 461 |
461 bp assembled on 2009-08-27
GenBank Submission: BT099652.1
> FI11929.complete ACTTTTCCCGTTTCTCCTGTTTTATTTGCCACGAAATGGTTTTGCTAGAC AATTCGAACTTTATCCTGCGCCTGGAGAAGATCGCAAATGCGGCCAAGAA GGACTCCTCCTTCACGCTGACGTTCAAGCGATATGATGGCAACGATAAGC CCGTGCCGAGGGAAGGACGGCCACCGCTGCCCAAGCCGGAGACCTACATG TGCCTGATGCGCGCCCAGTCCAAGTCCCAAAAAATTTCCACCGTTGTCCG GCAGGAGGATGTGCCCGCCATGATGAGCATGTACTCGCAGTTCATGAAGA GCAAGATGGACGGGCTAAAGCGGGTTAAGAAAGTCAAAAGCAAGGCCAAG GCGACAAAGGGTTAATCGGGGCATAGTCTTAGTTAGATTTTATTTGACTG TTTACTGGTCGTTTGTTTTAAACCTTAAATGCATCATTTTGTACGAAAAA AAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Srp14-RB | 621 | Srp14-RB | 137..585 | 1..449 | 2230 | 99.7 | Plus |
Srp14-RC | 689 | Srp14-RC | 337..653 | 133..449 | 1570 | 99.6 | Plus |
Srp14-RC | 689 | Srp14-RC | 137..272 | 1..136 | 665 | 99.2 | Plus |
CG34008-RA | 851 | CG34008-RA | 745..851 | 449..343 | 520 | 99 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 16404467..16404678 | 234..445 | 1060 | 100 | Plus |
chr3R | 27901430 | chr3R | 16404304..16404404 | 133..233 | 505 | 100 | Plus |
chr3R | 27901430 | chr3R | 16404163..16404239 | 60..136 | 370 | 98.7 | Plus |
chr3R | 27901430 | chr3R | 16404048..16404106 | 1..59 | 295 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 20580553..20580768 | 234..449 | 1065 | 99.5 | Plus |
3R | 32079331 | 3R | 20580390..20580490 | 133..233 | 505 | 100 | Plus |
3R | 32079331 | 3R | 20580249..20580325 | 60..136 | 370 | 98.7 | Plus |
3R | 32079331 | 3R | 20580134..20580192 | 1..59 | 295 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 20321384..20321599 | 234..449 | 1065 | 99.5 | Plus |
3R | 31820162 | 3R | 20321221..20321321 | 133..233 | 505 | 100 | Plus |
3R | 31820162 | 3R | 20321080..20321156 | 60..136 | 370 | 98.7 | Plus |
3R | 31820162 | 3R | 20320965..20321023 | 1..59 | 295 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 16404048..16404106 | 1..59 | 100 | -> | Plus |
chr3R | 16404163..16404235 | 60..132 | 100 | -> | Plus |
chr3R | 16404304..16404404 | 133..233 | 100 | -> | Plus |
chr3R | 16404467..16404678 | 234..445 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Srp14-RB | 1..330 | 36..365 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Srp14-RB | 1..330 | 36..365 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Srp14-RB | 1..330 | 36..365 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Srp14-RB | 1..330 | 36..365 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Srp14-RB | 7..446 | 1..440 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Srp14-RB | 11..455 | 1..445 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Srp14-RB | 20..464 | 1..445 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Srp14-RB | 20..464 | 1..445 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 20580249..20580321 | 60..132 | 100 | -> | Plus |
3R | 20580390..20580490 | 133..233 | 100 | -> | Plus |
3R | 20580553..20580764 | 234..445 | 100 | Plus | |
3R | 20580134..20580192 | 1..59 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 20580249..20580321 | 60..132 | 100 | -> | Plus |
3R | 20580390..20580490 | 133..233 | 100 | -> | Plus |
3R | 20580553..20580764 | 234..445 | 100 | Plus | |
3R | 20580134..20580192 | 1..59 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 20580249..20580321 | 60..132 | 100 | -> | Plus |
3R | 20580390..20580490 | 133..233 | 100 | -> | Plus |
3R | 20580553..20580764 | 234..445 | 100 | Plus | |
3R | 20580134..20580192 | 1..59 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 16405856..16405914 | 1..59 | 100 | -> | Plus |
arm_3R | 16405971..16406043 | 60..132 | 100 | -> | Plus |
arm_3R | 16406112..16406212 | 133..233 | 100 | -> | Plus |
arm_3R | 16406275..16406486 | 234..445 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 20321384..20321595 | 234..445 | 100 | Plus | |
3R | 20320965..20321023 | 1..59 | 100 | -> | Plus |
3R | 20321080..20321152 | 60..132 | 100 | -> | Plus |
3R | 20321221..20321321 | 133..233 | 100 | -> | Plus |
Translation from 2 to 364
> FI11929.pep FSRFSCFICHEMVLLDNSNFILRLEKIANAAKKDSSFTLTFKRYDGNDKP VPREGRPPLPKPETYMCLMRAQSKSQKISTVVRQEDVPAMMSMYSQFMKS KMDGLKRVKKVKSKAKATKG*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF16681-PA | 109 | GF16681-PA | 1..94 | 12..105 | 458 | 90.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG23978-PA | 109 | GG23978-PA | 1..94 | 12..105 | 473 | 94.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH17169-PA | 109 | GH17169-PA | 1..94 | 12..105 | 417 | 84 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Srp14-PB | 109 | CG5417-PB | 1..109 | 12..120 | 552 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI10582-PA | 109 | GI10582-PA | 1..96 | 12..107 | 456 | 87.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL13565-PA | 109 | GL13565-PA | 1..94 | 12..105 | 454 | 90.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA18867-PA | 109 | GA18867-PA | 1..94 | 12..105 | 454 | 90.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM23120-PA | 109 | GM23120-PA | 1..109 | 12..120 | 558 | 98.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD19359-PA | 199 | GD19359-PA | 80..199 | 1..120 | 630 | 98.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ22939-PA | 109 | GJ22939-PA | 1..94 | 12..105 | 416 | 84 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK22455-PA | 109 | GK22455-PA | 1..94 | 12..105 | 462 | 91.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE25671-PA | 122 | GE25671-PA | 3..122 | 1..120 | 618 | 97.5 | Plus |
Translation from 2 to 364
> FI11929.hyp FSRFSCFICHEMVLLDNSNFILRLEKIANAAKKDSSFTLTFKRYDGNDKP VPREGRPPLPKPETYMCLMRAQSKSQKISTVVRQEDVPAMMSMYSQFMKS KMDGLKRVKKVKSKAKATKG*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Srp14-PB | 109 | CG5417-PB | 1..109 | 12..120 | 552 | 100 | Plus |