Clone FI12505 Report

Search the DGRC for FI12505

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:125
Well:5
Vector:pOTB7
Associated Gene/TranscriptCG33223-RA
Protein status:FI12505.pep: gold
Sequenced Size:754

Clone Sequence Records

FI12505.complete Sequence

754 bp assembled on 2009-08-26

GenBank Submission: BT099647.1

> FI12505.complete
CAAACTTCTATCCGAATAAAGCAGACTACACCTAGAGACACAGAGCTTGT
GTATAAAATCTAAAATTATCTATATATATATATATATATATATATAAATT
CGGGCATCAGGATGCGGAAGGTGCAGGCTTTGGTTCAGACGCGCGACGGC
AAGAAGACCGTCTACGAGGTGGATCGCTTAGGAACGGTGGCCAGCCTGAA
GGCACGGATCGGGCAAGCCATGTCCGTGCCCATGGGCTTCAGTCGGCTGT
CGTACAAGGGTCGCGTGCTATCCAATCAGAGCGTACTGGAGGATTTGGGG
CCCAATAAGTCCACCCTGGATCTCACCTGGAAGCCGGTCGTCCTGACGGC
CAATCAGAGCAGCAAGTTAAGCAAGTTCGGCTATGGCAGGATAGACGATA
GTGAAGTTATGTTTACACTGATCGGCGGCTACCAGCAACGCGAAGAATAT
CCTGGTGGCATAGTCAATCCACCGGACGACGAAAGTCAACAAAACTTCAA
CGCAGGTGACGATGATGATGCACTGGAGGCCCAGGACATGACTGGACACG
ATTTGTCCTCAATTCAAACCGATGATTTATCGCTCAAAGGCCAGACGGAA
CCGGAGCTGGATTGCTCCATTGGATCTCATGGATTCTCTGGATCTCAAGA
AGAAGGCCAAGAATAACGACAATGTGTAGTAGACTGTTGTAAATTATTTT
AAATTAAAAAGATTTAGTCCTCGTTTCAGTCCTCAAAAAAAAAAAAAAAA
AAAA

FI12505.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:33:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG33223-RA 1046 CG33223-RA 381..1046 1..666 3330 100 Plus
CG32713-RA 555 CG32713-RA 1..555 112..666 2640 98.3 Plus
CG12725-RA 1025 CG12725-RA 116..388 78..353 860 88 Plus
CG12725-RA 1025 CG12725-RA 412..453 362..403 165 92.8 Plus
CG12725-RA 1025 CG12725-RA 624..699 634..709 155 80.2 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:53:44
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 8357468..8358201 734..1 3655 99.9 Minus
chrX 22417052 chrX 8348723..8349454 726..1 3280 96.9 Minus
chrX 22417052 chrX 13293166..13293544 441..78 830 83 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:23:45 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:53:42
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 8465688..8466423 736..1 3680 100 Minus
X 23542271 X 8456946..8457677 726..1 3280 96.9 Minus
X 23542271 X 13402370..13402748 441..78 860 83.5 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:50:39
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 8473786..8474521 736..1 3680 100 Minus
X 23527363 X 8465044..8465775 726..1 3290 96.8 Minus
X 23527363 X 13410574..13410846 353..78 860 88 Minus
X 23527363 X 13410509..13410550 403..362 165 92.8 Minus
X 23527363 X 13410263..13410338 709..634 155 80.2 Minus
Blast to na_te.dros performed on 2019-03-15 18:53:43 has no hits.

FI12505.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:54:42 Download gff for FI12505.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 8357468..8358201 1..734 92   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:14:49 Download gff for FI12505.complete
Subject Subject Range Query Range Percent Splice Strand
CG33223-RA 1..555 112..666 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:51:38 Download gff for FI12505.complete
Subject Subject Range Query Range Percent Splice Strand
CG33223-RA 1..555 112..666 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:34:46 Download gff for FI12505.complete
Subject Subject Range Query Range Percent Splice Strand
CG33223-RA 1..555 112..666 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:03:49 Download gff for FI12505.complete
Subject Subject Range Query Range Percent Splice Strand
CG33223-RA 1..555 112..666 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-08-26 18:28:30 Download gff for FI12505.complete
Subject Subject Range Query Range Percent Splice Strand
CG33223-RA 381..1046 1..666 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:51:37 Download gff for FI12505.complete
Subject Subject Range Query Range Percent Splice Strand
CG33223-RA 381..1114 1..734 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:34:46 Download gff for FI12505.complete
Subject Subject Range Query Range Percent Splice Strand
CG33223-RA 381..1114 1..734 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:03:49 Download gff for FI12505.complete
Subject Subject Range Query Range Percent Splice Strand
CG33223-RA 381..1114 1..734 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:54:42 Download gff for FI12505.complete
Subject Subject Range Query Range Percent Splice Strand
X 8465690..8466423 1..734 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:54:42 Download gff for FI12505.complete
Subject Subject Range Query Range Percent Splice Strand
X 8465690..8466423 1..734 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:54:42 Download gff for FI12505.complete
Subject Subject Range Query Range Percent Splice Strand
X 8465690..8466423 1..734 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:34:46 Download gff for FI12505.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 8359723..8360456 1..734 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:27:43 Download gff for FI12505.complete
Subject Subject Range Query Range Percent Splice Strand
X 8473788..8474521 1..734 100   Minus

FI12505.pep Sequence

Translation from 111 to 665

> FI12505.pep
MRKVQALVQTRDGKKTVYEVDRLGTVASLKARIGQAMSVPMGFSRLSYKG
RVLSNQSVLEDLGPNKSTLDLTWKPVVLTANQSSKLSKFGYGRIDDSEVM
FTLIGGYQQREEYPGGIVNPPDDESQQNFNAGDDDDALEAQDMTGHDLSS
IQTDDLSLKGQTEPELDCSIGSHGFSGSQEEGQE*

FI12505.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:41:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22365-PA 267 GF22365-PA 1..83 1..82 297 67.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:41:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19048-PA 205 GG19048-PA 1..137 1..131 412 62 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:41:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12233-PA 234 GH12233-PA 1..86 1..85 261 58.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:39:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG33223-PB 184 CG33223-PB 1..184 1..184 945 100 Plus
CG33223-PA 184 CG33223-PA 1..184 1..184 945 100 Plus
CG32713-PB 184 CG32713-PB 1..184 1..184 923 97.3 Plus
CG32713-PA 184 CG32713-PA 1..184 1..184 923 97.3 Plus
CG12725-PA 163 CG12725-PA 1..162 1..178 461 60.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:41:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15768-PA 343 GI15768-PA 1..83 1..82 256 59 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:41:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20310-PA 226 GL20310-PA 1..84 4..86 205 47.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:41:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28796-PA 226 GA28796-PA 1..84 4..86 206 47.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:41:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21312-PA 189 GM21312-PA 1..165 1..167 634 76 Plus
Dsec\GM21345-PA 188 GM21345-PA 1..164 1..165 630 74.5 Plus
Dsec\GM12963-PA 162 GM12963-PA 1..162 1..179 500 63.1 Plus
Dsec\GM22658-PA 162 GM22658-PA 1..162 1..179 499 62.6 Plus
Dsec\GM11493-PA 171 GM11493-PA 1..146 1..163 430 58.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:41:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16114-PA 183 GD16114-PA 1..159 1..167 577 70.1 Plus
Dsim\GD16110-PA 181 GD16110-PA 1..157 1..167 540 70.1 Plus
Dsim\GD15887-PA 136 GD15887-PA 1..110 37..163 281 51.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:42:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18624-PA 313 GJ18624-PA 1..83 1..82 262 60.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:42:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19892-PA 254 GK19892-PA 1..80 4..82 244 52.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:42:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17453-PA 238 GE17453-PA 1..185 1..163 390 55.1 Plus

FI12505.hyp Sequence

Translation from 111 to 665

> FI12505.hyp
MRKVQALVQTRDGKKTVYEVDRLGTVASLKARIGQAMSVPMGFSRLSYKG
RVLSNQSVLEDLGPNKSTLDLTWKPVVLTANQSSKLSKFGYGRIDDSEVM
FTLIGGYQQREEYPGGIVNPPDDESQQNFNAGDDDDALEAQDMTGHDLSS
IQTDDLSLKGQTEPELDCSIGSHGFSGSQEEGQE*

FI12505.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:53:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG33223-PB 184 CG33223-PB 1..184 1..184 945 100 Plus
CG33223-PA 184 CG33223-PA 1..184 1..184 945 100 Plus
CG32713-PB 184 CG32713-PB 1..184 1..184 923 97.3 Plus
CG32713-PA 184 CG32713-PA 1..184 1..184 923 97.3 Plus
CG12725-PA 163 CG12725-PA 1..162 1..178 461 60.3 Plus