Clone FI14002 Report

Search the DGRC for FI14002

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:140
Well:2
Vector:pOT2
Associated Gene/TranscriptCG30285-RA
Protein status:FI14002.pep: gold
Sequenced Size:570

Clone Sequence Records

FI14002.complete Sequence

570 bp assembled on 2010-01-25

GenBank Submission: BT120159.1

> FI14002.complete
GAAACTGCATCATGAGATCGTGTACTTTACTTGTTTTCATAGTGAGCACG
CTGTTGTTTGCCGTGACAAATGCGCAGCAGAATTATGATGGAAGAAATGG
TCCCCATGAGTTCGGCACACCTGGAAACGGCATTTACATACGGGGTCAGA
ACGAAGGACCCTACACAGTGCCCGAAATGGGAGGAACGTTCCAAAACTCA
CCCTCAAGTGGGCAGCATTCCTACACCGATGAGCACGGAAATACTTACAC
CCATTCCTCAACGGCAACTGTCACAAGTTTGGCCTATTCAACCTTCGGTT
TCAGCATGGGCGGCGTTCTCATTTTTCTAATTAGTTTAATAACCATTTAA
TTGCACTTTCCAAGTGCAAAAGTTCCAATTAATTAATTTTTAACACATCG
TTTTTCAGTTCACGCCCACGAAAATCTATTGCTGAAACTGCATAGATGAG
AATAACCATTTTCCTTCTAAGTATTATGCACTATTATTTATTCGCTATTT
CTTTTGTTCACCTTATACACAAATTATTTAGCTATTAAACAGAAGTACAA
CAAAAAAAAAAAAAAAAAAA

FI14002.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:34:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG30285-RA 794 CG30285-RA 242..794 1..553 2765 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:06:01
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 17574390..17574878 551..63 2415 99.6 Minus
chr2R 21145070 chr2R 17574946..17575006 63..3 305 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:24:27 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:05:59
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21687900..21688391 554..63 2460 100 Minus
2R 25286936 2R 21688459..21688521 63..1 315 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:51:19
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 21689099..21689590 554..63 2460 100 Minus
2R 25260384 2R 21689658..21689720 63..1 315 100 Minus
Blast to na_te.dros performed on 2019-03-15 23:06:00 has no hits.

FI14002.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:06:44 Download gff for FI14002.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 17574390..17574877 64..551 99 <- Minus
chr2R 17574946..17575007 1..63 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-01-25 10:37:45 Download gff for FI14002.complete
Subject Subject Range Query Range Percent Splice Strand
CG30285-RA 1..339 12..350 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:52:43 Download gff for FI14002.complete
Subject Subject Range Query Range Percent Splice Strand
CG30285-RA 1..339 12..350 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:27:26 Download gff for FI14002.complete
Subject Subject Range Query Range Percent Splice Strand
CG30285-RA 1..339 12..350 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:19:03 Download gff for FI14002.complete
Subject Subject Range Query Range Percent Splice Strand
CG30285-RA 1..339 12..350 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-01-25 10:37:43 Download gff for FI14002.complete
Subject Subject Range Query Range Percent Splice Strand
CG30285-RA 1..551 1..551 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:52:43 Download gff for FI14002.complete
Subject Subject Range Query Range Percent Splice Strand
CG30285-RA 1..551 1..551 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:27:26 Download gff for FI14002.complete
Subject Subject Range Query Range Percent Splice Strand
CG30285-RA 25..575 1..551 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:19:03 Download gff for FI14002.complete
Subject Subject Range Query Range Percent Splice Strand
CG30285-RA 25..575 1..551 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:06:44 Download gff for FI14002.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21687903..21688390 64..551 100 <- Minus
2R 21688459..21688521 1..63 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:06:44 Download gff for FI14002.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21687903..21688390 64..551 100 <- Minus
2R 21688459..21688521 1..63 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:06:44 Download gff for FI14002.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21687903..21688390 64..551 100 <- Minus
2R 21688459..21688521 1..63 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:27:26 Download gff for FI14002.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17575408..17575895 64..551 100 <- Minus
arm_2R 17575964..17576026 1..63 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:28:55 Download gff for FI14002.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21689658..21689720 1..63 100   Minus
2R 21689102..21689589 64..551 100 <- Minus

FI14002.hyp Sequence

Translation from 2 to 349

> FI14002.hyp
NCIMRSCTLLVFIVSTLLFAVTNAQQNYDGRNGPHEFGTPGNGIYIRGQN
EGPYTVPEMGGTFQNSPSSGQHSYTDEHGNTYTHSSTATVTSLAYSTFGF
SMGGVLIFLISLITI*

FI14002.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:54:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG30285-PA 112 CG30285-PA 1..112 4..115 591 100 Plus
CG33470-PC 257 CG33470-PC 1..85 4..88 254 51.8 Plus
CG33470-PA 257 CG33470-PA 1..85 4..88 254 51.8 Plus
IM10-PC 257 CG18279-PC 1..85 4..88 254 51.8 Plus
IM10-PA 257 CG18279-PA 1..85 4..88 254 51.8 Plus

FI14002.pep Sequence

Translation from 2 to 349

> FI14002.pep
NCIMRSCTLLVFIVSTLLFAVTNAQQNYDGRNGPHEFGTPGNGIYIRGQN
EGPYTVPEMGGTFQNSPSSGQHSYTDEHGNTYTHSSTATVTSLAYSTFGF
SMGGVLIFLISLITI*

FI14002.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:30:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13690-PA 259 GF13690-PA 1..95 4..98 236 47.4 Plus
Dana\GF12218-PA 228 GF12218-PA 1..85 4..88 228 51.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:30:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20752-PA 112 GG20752-PA 1..112 4..115 496 85.7 Plus
Dere\GG20379-PA 257 GG20379-PA 1..85 4..88 254 52.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 20:30:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23113-PA 360 GH23113-PA 2..70 20..88 247 63.8 Plus
Dgri\GH23113-PA 360 GH23113-PA 75..143 20..88 247 63.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:12:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG30285-PA 112 CG30285-PA 1..112 4..115 591 100 Plus
IMPPP-PC 257 CG18279-PC 1..85 4..88 254 51.8 Plus
IMPPP-PA 257 CG18279-PA 1..85 4..88 254 51.8 Plus
CG33470-PC 257 CG33470-PC 1..85 4..88 254 51.8 Plus
CG33470-PA 257 CG33470-PA 1..85 4..88 254 51.8 Plus
CG13749-PB 183 CG13749-PB 16..84 20..88 214 53.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 20:30:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18936-PA 241 GI18936-PA 5..66 21..81 227 74.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:30:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11270-PA 112 GL11270-PA 1..109 4..115 287 53.6 Plus
Dper\GL11683-PA 305 GL11683-PA 18..85 21..88 237 63.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:30:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15751-PA 112 GA15751-PA 1..104 4..109 308 56.6 Plus
Dpse\GA24235-PA 278 GA24235-PA 18..85 21..88 243 64.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:30:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15695-PA 112 GM15695-PA 1..112 4..115 509 87.5 Plus
Dsec\GM21466-PA 257 GM21466-PA 1..83 4..86 245 51.8 Plus
Dsec\GM21080-PA 272 GM21080-PA 26..105 3..86 220 51.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:30:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25174-PA 112 GD25174-PA 1..112 4..115 444 86.6 Plus
Dsim\GD10965-PA 268 GD10965-PA 1..100 4..97 243 47 Plus
Dsim\GD10615-PA 245 GD10615-PA 41..106 23..88 220 60.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 20:30:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21308-PA 269 GJ21308-PA 4..86 20..102 257 59 Plus
Dvir\GJ21309-PA 351 GJ21309-PA 1..82 21..102 209 51.2 Plus
Dvir\GJ21309-PA 351 GJ21309-PA 269..340 21..92 199 54.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:30:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10645-PA 175 GK10645-PA 1..84 4..89 263 59.3 Plus
Dwil\GK10648-PA 346 GK10648-PA 21..82 25..86 238 66.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:30:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13684-PA 119 GE13684-PA 1..118 4..114 401 69.2 Plus
Dyak\GE12540-PA 259 GE12540-PA 1..85 4..88 240 50.6 Plus
Dyak\GE19241-PA 251 GE19241-PA 6..85 9..88 190 51.2 Plus