Clone FI14079 Report

Search the DGRC for FI14079

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:140
Well:79
Vector:pOT2
Associated Gene/TranscriptCG9067-RA
Protein status:FI14079.pep: gold
Sequenced Size:530

Clone Sequence Records

FI14079.complete Sequence

530 bp assembled on 2010-01-25

GenBank Submission: BT120160.1

> FI14079.complete
CAAAATATGGCATTTTGCATAGCAGTTATTGGCAAGGATAACGCCCCCCT
GTACCTGACCACATCCGATATGGAGCAGGAACTGGAATTGCAATATCATG
TTAACGCCGCCTTAGACGTCGTGGAGGAGAAGTGCCTGATTGGCAAGGGT
GCTCCGGAGTCCAAGGAGCTGTACCTGGGACTGCTCTACTCGACAGAGAA
CCACAAAATATACGGCTTTGTGACCAACACTCGGGTGAAATTCATAGTGG
TCATCGACTCCAGCAACGTTGCCCTTCGGGAAAACGAAGTTCGAGCAATC
TTCCGAAATCTCCACTTGCTCTACACCGATGCCATCTGCAATCCCTTTTA
CATTCCCGGCGAATCGCTGACTTCAAAGAAGTTCGATCGCGCTGTCCAGA
AACTGATGAGCGGCACTGCCTAGCTGTAGATTAATACTGAACGAATAATA
AAGCGAATTATTTATCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

FI14079.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:34:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG9067-RA 548 CG9067-RA 83..548 1..466 2330 100 Plus
CG9067.a 552 CG9067.a 83..552 1..466 2265 99.1 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:47:15
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 7166787..7166960 213..40 855 99.4 Minus
chr2R 21145070 chr2R 7166353..7166441 466..378 445 100 Minus
chr2R 21145070 chr2R 7166643..7166730 297..210 440 100 Minus
chr2R 21145070 chr2R 7166497..7166577 378..298 405 100 Minus
chr2R 21145070 chr2R 7167015..7167053 39..1 195 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:24:28 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:47:13
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11279335..11279508 213..40 855 99.4 Minus
2R 25286936 2R 11278890..11278981 469..378 460 100 Minus
2R 25286936 2R 11279191..11279278 297..210 440 100 Minus
2R 25286936 2R 11279045..11279125 378..298 405 100 Minus
2R 25286936 2R 11279563..11279601 39..1 195 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:51:31
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 11280534..11280707 213..40 855 99.4 Minus
2R 25260384 2R 11280089..11280180 469..378 460 100 Minus
2R 25260384 2R 11280390..11280477 297..210 440 100 Minus
2R 25260384 2R 11280244..11280324 378..298 405 100 Minus
2R 25260384 2R 11280762..11280800 39..1 195 100 Minus
Blast to na_te.dros performed on 2019-03-16 10:47:13 has no hits.

FI14079.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:48:22 Download gff for FI14079.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 7166353..7166441 378..466 100 <- Minus
chr2R 7166498..7166577 298..377 100 <- Minus
chr2R 7166643..7166730 210..297 100 <- Minus
chr2R 7166791..7166960 40..209 100 <- Minus
chr2R 7167015..7167053 1..39 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-01-25 10:43:30 Download gff for FI14079.complete
Subject Subject Range Query Range Percent Splice Strand
CG9067-RA 1..417 7..423 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:53:02 Download gff for FI14079.complete
Subject Subject Range Query Range Percent Splice Strand
CG9067-RA 1..417 7..423 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:57:07 Download gff for FI14079.complete
Subject Subject Range Query Range Percent Splice Strand
CG9067-RA 1..417 7..423 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:16:24 Download gff for FI14079.complete
Subject Subject Range Query Range Percent Splice Strand
CG9067-RA 1..417 7..423 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-01-25 10:43:30 Download gff for FI14079.complete
Subject Subject Range Query Range Percent Splice Strand
CG9067-RA 1..466 1..466 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:53:02 Download gff for FI14079.complete
Subject Subject Range Query Range Percent Splice Strand
CG9067-RA 1..466 1..466 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:57:07 Download gff for FI14079.complete
Subject Subject Range Query Range Percent Splice Strand
CG9067-RA 83..548 1..466 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:16:24 Download gff for FI14079.complete
Subject Subject Range Query Range Percent Splice Strand
CG9067-RA 83..548 1..466 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:48:22 Download gff for FI14079.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11279563..11279601 1..39 100   Minus
2R 11278893..11278981 378..466 100 <- Minus
2R 11279046..11279125 298..377 100 <- Minus
2R 11279191..11279278 210..297 100 <- Minus
2R 11279339..11279508 40..209 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:48:22 Download gff for FI14079.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11279563..11279601 1..39 100   Minus
2R 11278893..11278981 378..466 100 <- Minus
2R 11279046..11279125 298..377 100 <- Minus
2R 11279191..11279278 210..297 100 <- Minus
2R 11279339..11279508 40..209 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:48:22 Download gff for FI14079.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11279563..11279601 1..39 100   Minus
2R 11278893..11278981 378..466 100 <- Minus
2R 11279046..11279125 298..377 100 <- Minus
2R 11279191..11279278 210..297 100 <- Minus
2R 11279339..11279508 40..209 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:57:07 Download gff for FI14079.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7166696..7166783 210..297 100 <- Minus
arm_2R 7166844..7167013 40..209 100 <- Minus
arm_2R 7167068..7167106 1..39 100   Minus
arm_2R 7166398..7166486 378..466 100 <- Minus
arm_2R 7166551..7166630 298..377 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:29:18 Download gff for FI14079.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11280092..11280180 378..466 100 <- Minus
2R 11280245..11280324 298..377 100 <- Minus
2R 11280390..11280477 210..297 100 <- Minus
2R 11280538..11280707 40..209 100 <- Minus
2R 11280762..11280800 1..39 100   Minus

FI14079.hyp Sequence

Translation from 0 to 422

> FI14079.hyp
QNMAFCIAVIGKDNAPLYLTTSDMEQELELQYHVNAALDVVEEKCLIGKG
APESKELYLGLLYSTENHKIYGFVTNTRVKFIVVIDSSNVALRENEVRAI
FRNLHLLYTDAICNPFYIPGESLTSKKFDRAVQKLMSGTA*

FI14079.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:47:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG9067-PA 138 CG9067-PA 1..138 3..140 705 100 Plus

FI14079.pep Sequence

Translation from 0 to 422

> FI14079.pep
QNMAFCIAVIGKDNAPLYLTTSDMEQELELQYHVNAALDVVEEKCLIGKG
APESKELYLGLLYSTENHKIYGFVTNTRVKFIVVIDSSNVALRENEVRAI
FRNLHLLYTDAICNPFYIPGESLTSKKFDRAVQKLMSGTA*

FI14079.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:30:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12421-PA 138 GF12421-PA 1..138 3..140 695 92.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:30:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22679-PA 138 GG22679-PA 1..138 3..140 726 97.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 20:30:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21937-PA 138 GH21937-PA 1..136 3..138 678 91.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:19:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG9067-PA 138 CG9067-PA 1..138 3..140 705 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 20:30:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19645-PA 138 GI19645-PA 1..136 3..138 662 88.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:30:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16746-PA 137 GL16746-PA 1..137 3..140 681 92 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:30:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21516-PA 137 GA21516-PA 1..137 3..140 681 92 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:30:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20457-PA 138 GM20457-PA 1..138 3..140 720 97.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:30:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25925-PA 138 GD25925-PA 1..138 3..140 727 98.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 20:30:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15010-PA 138 GJ15010-PA 1..138 3..140 685 89.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:30:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21624-PA 138 GK21624-PA 1..138 3..140 687 91.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:30:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13035-PA 138 GE13035-PA 1..138 3..140 728 98.6 Plus