Clone FI14101 Report

Search the DGRC for FI14101

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:141
Well:1
Vector:pOT2
Associated Gene/TranscriptCG13474-RA
Protein status:FI14101.pep: gold
Sequenced Size:575

Clone Sequence Records

FI14101.complete Sequence

575 bp assembled on 2010-03-24

GenBank Submission: BT122126.1

> FI14101.complete
AAATCATGCTACTACAAGCGGAATTTACAAAAATCGACGATGCCCTTGAC
ATCTGTAGCTCCATGGAGGAGGATCTGAACGAGTGTCTGAATATCGTAGG
GGCCATGATCGAGAAGTACAATGCTCCCGGACGCTACATCATATCCATGG
ATCCCTTCGCTGAGGATTTTCAACTAAGCAACAGCGAGTCCACGGACTTG
GATGGGTCGTCTATTGGAAGTTGTGACTCCGAGCTGGACATGCTAAGCCA
ACTCTACGGAGCCAGAAGTGCCCAGGAGTTGGATGAATCTTACGTCGATG
TGCGCTATAAGTTTATCAAGCTGAAGCGGTTCTTCGAGGGTACCTTTACC
CATTTTCTAAGGATCGTTGACTGTGCTGATCGTCAAAATAAGATTTCACA
TCGCATTTTTATGAACTCGCAGGATACCAAGGGGAAGCGGTGCAGGCACT
AGGAATGCAAATTTCCTCCAACTATTCCATCAAACTTGCGCGCGTGTGTA
AACTGCAAATTGTGTCGACACTTGGCAGGTTTTATTAAAAATTACTGTCA
CCATTAAAAAAAAAAAAAAAAAAAA

FI14101.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:37:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG13474-RA 556 CG13474-RA 1..556 1..556 2720 99.2 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:53:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 14686689..14687243 555..1 2775 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:24:29 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:53:45
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 14696550..14697105 556..1 2720 99.3 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:54:15
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 14689650..14690205 556..1 2720 99.2 Minus
Blast to na_te.dros performed on 2019-03-15 18:53:45 has no hits.

FI14101.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:54:44 Download gff for FI14101.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 14686689..14687243 1..555 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-03-24 16:20:08 Download gff for FI14101.complete
Subject Subject Range Query Range Percent Splice Strand
CG13474-RA 1..447 6..452 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:57:41 Download gff for FI14101.complete
Subject Subject Range Query Range Percent Splice Strand
CG13474-RA 1..447 6..452 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:34:49 Download gff for FI14101.complete
Subject Subject Range Query Range Percent Splice Strand
CG13474-RA 1..447 6..452 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:03:52 Download gff for FI14101.complete
Subject Subject Range Query Range Percent Splice Strand
CG13474-RA 1..447 6..452 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-03-24 16:20:06 Download gff for FI14101.complete
Subject Subject Range Query Range Percent Splice Strand
CG13474-RA 1..555 1..555 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:57:41 Download gff for FI14101.complete
Subject Subject Range Query Range Percent Splice Strand
CG13474-RA 1..555 1..555 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:34:49 Download gff for FI14101.complete
Subject Subject Range Query Range Percent Splice Strand
CG13474-RA 1..555 1..555 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:03:52 Download gff for FI14101.complete
Subject Subject Range Query Range Percent Splice Strand
CG13474-RA 1..555 1..555 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:54:44 Download gff for FI14101.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14696551..14697105 1..555 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:54:44 Download gff for FI14101.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14696551..14697105 1..555 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:54:44 Download gff for FI14101.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14696551..14697105 1..555 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:34:49 Download gff for FI14101.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 14689651..14690205 1..555 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:34:29 Download gff for FI14101.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14689651..14690205 1..555 99   Minus

FI14101.hyp Sequence

Translation from 2 to 451

> FI14101.hyp
IMLLQAEFTKIDDALDICSSMEEDLNECLNIVGAMIEKYNAPGRYIISMD
PFAEDFQLSNSESTDLDGSSIGSCDSELDMLSQLYGARSAQELDESYVDV
RYKFIKLKRFFEGTFTHFLRIVDCADRQNKISHRIFMNSQDTKGKRCRH*

FI14101.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:46:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG13474-PA 148 CG13474-PA 1..148 2..149 769 100 Plus

FI14101.pep Sequence

Translation from 2 to 451

> FI14101.pep
IMLLQAEFTKIDDALDICSSMEEDLNECLNIVGAMIEKYNAPGRYIISMD
PFAEDFQLSNSESTDLDGSSIGSCDSELDMLSQLYGARSAQELDESYVDV
RYKFIKLKRFFEGTFTHFLRIVDCADRQNKISHRIFMNSQDTKGKRCRH*

FI14101.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 21:29:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20103-PA 157 GF20103-PA 7..156 1..149 431 54.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:29:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13715-PA 148 GG13715-PA 1..148 2..149 572 74.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:22:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG13474-PA 148 CG13474-PA 1..148 2..149 769 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 21:29:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13811-PA 180 GI13811-PA 1..152 3..149 212 33.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 21:29:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26139-PA 149 GL26139-PA 7..131 4..128 174 38.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 21:29:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12312-PA 149 GA12312-PA 7..131 4..128 176 39.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:29:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24536-PA 148 GM24536-PA 1..148 2..149 687 87.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:29:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12610-PA 148 GD12610-PA 1..148 2..149 665 85.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 21:29:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11676-PA 188 GJ11676-PA 1..151 3..149 192 29.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:29:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20011-PA 148 GE20011-PA 1..148 2..149 601 78.4 Plus