BDGP Sequence Production Resources |
Search the DGRC for FI14102
Library: | FI |
Tissue Source: | various Drosophila melanogaster |
Created by: | |
Date Registered: | 2005-11-08 |
Comments: | Drosophila melanogaster corrected cDNA clones |
Original Plate Number: | 141 |
Well: | 2 |
Vector: | pOT2 |
Associated Gene/Transcript | CG12269-RA |
Protein status: | FI14102.pep: gold |
Sequenced Size: | 452 |
452 bp assembled on 2010-03-24
GenBank Submission: BT122115.1
> FI14102.complete CAACATGAAGAGCGACGAGATCATCGAGAAGATACGCAACAAGTTGAAGG AATCGGATCCTGCCCGGCGCACCGTCGTCAACACGTTTCAGTTCAACTTC ACCGATGCGGATGGTAATCTCATCAAGAGCATGGCGTTGGACATCTACGA GGGGAGTGCCACCAGTGTCGATGCACAGGTCACCATTTCCGATGAGGACT TCTACTTGGTGGGCACTAAGCAGAAGACTTTCCAGGAGGTGTTGCAGCAG GAGAAGGCTAAGATCGATGGCGATGAGGAGGCTATCAACAAAATGCTGGA GAAGTTTCGCATAAATTCTCAAAACTAGCTCGGTGTCAAAAGTAATTATG CATGCATTTCGTTTATTATATGCGACAATTTAACGTTTATTGTTTATTCA CTTCACCCCAATAATAAATTATAACAAATTAAAAAAAAAAAAAAAAAAAA AA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG12269-RA | 602 | CG12269-RA | 117..550 | 1..434 | 2170 | 100 | Plus |
CG12269.a | 742 | CG12269.a | 390..690 | 134..434 | 1505 | 100 | Plus |
CG12269.b | 686 | CG12269.b | 390..686 | 134..430 | 1485 | 100 | Plus |
CG12269.a | 742 | CG12269.a | 242..375 | 1..134 | 670 | 100 | Plus |
CG12269.b | 686 | CG12269.b | 242..375 | 1..134 | 670 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
rooA | 7621 | rooA ROOA_LTR 7621bp | 6262..6318 | 287..342 | 111 | 70.7 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 14802214..14802486 | 135..408 | 99 | <- | Minus |
chr3R | 14802562..14802695 | 1..134 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12269-RA | 1..324 | 5..328 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12269-RA | 1..324 | 5..328 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12269-RA | 1..324 | 5..328 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12269-RA | 1..324 | 5..328 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12269-RA | 33..434 | 1..402 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12269-RA | 33..434 | 1..402 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12269-RA | 33..462 | 1..430 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12269-RA | 33..462 | 1..430 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 18978273..18978568 | 135..430 | 100 | <- | Minus |
3R | 18978644..18978777 | 1..134 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 18978273..18978568 | 135..430 | 100 | <- | Minus |
3R | 18978644..18978777 | 1..134 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 18978273..18978568 | 135..430 | 100 | <- | Minus |
3R | 18978644..18978777 | 1..134 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 14803995..14804290 | 135..430 | 100 | <- | Minus |
arm_3R | 14804366..14804499 | 1..134 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 18719104..18719399 | 135..430 | 100 | <- | Minus |
3R | 18719475..18719608 | 1..134 | 100 | Minus |
Translation from 1 to 327
> FI14102.hyp NMKSDEIIEKIRNKLKESDPARRTVVNTFQFNFTDADGNLIKSMALDIYE GSATSVDAQVTISDEDFYLVGTKQKTFQEVLQQEKAKIDGDEEAINKMLE KFRINSQN*
Translation from 1 to 327
> FI14102.pep NMKSDEIIEKIRNKLKESDPARRTVVNTFQFNFTDADGNLIKSMALDIYE GSATSVDAQVTISDEDFYLVGTKQKTFQEVLQQEKAKIDGDEEAINKMLE KFRINSQN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF23010-PA | 107 | GF23010-PA | 1..107 | 2..108 | 519 | 93.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG16262-PA | 107 | GG16262-PA | 1..107 | 2..108 | 537 | 97.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH17450-PA | 107 | GH17450-PA | 1..107 | 2..108 | 465 | 81.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
euc-PA | 107 | CG12269-PA | 1..107 | 2..108 | 533 | 100 | Plus |
euc-PB | 112 | CG12269-PB | 1..112 | 2..108 | 517 | 95.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI22776-PA | 107 | GI22776-PA | 1..106 | 2..107 | 460 | 80.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL24106-PA | 107 | GL24106-PA | 1..107 | 2..108 | 504 | 89.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA11522-PA | 107 | GA11522-PA | 1..107 | 2..108 | 507 | 90.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM13649-PA | 107 | GM13649-PA | 1..107 | 2..108 | 538 | 97.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD20142-PA | 107 | GD20142-PA | 1..107 | 2..108 | 511 | 91.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ22778-PA | 109 | GJ22778-PA | 1..106 | 2..107 | 451 | 79.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK22434-PA | 112 | GK22434-PA | 1..112 | 2..108 | 442 | 76.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE25161-PA | 107 | GE25161-PA | 1..107 | 2..108 | 537 | 97.2 | Plus |