Clone FI14102 Report

Search the DGRC for FI14102

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:141
Well:2
Vector:pOT2
Associated Gene/TranscriptCG12269-RA
Protein status:FI14102.pep: gold
Sequenced Size:452

Clone Sequence Records

FI14102.complete Sequence

452 bp assembled on 2010-03-24

GenBank Submission: BT122115.1

> FI14102.complete
CAACATGAAGAGCGACGAGATCATCGAGAAGATACGCAACAAGTTGAAGG
AATCGGATCCTGCCCGGCGCACCGTCGTCAACACGTTTCAGTTCAACTTC
ACCGATGCGGATGGTAATCTCATCAAGAGCATGGCGTTGGACATCTACGA
GGGGAGTGCCACCAGTGTCGATGCACAGGTCACCATTTCCGATGAGGACT
TCTACTTGGTGGGCACTAAGCAGAAGACTTTCCAGGAGGTGTTGCAGCAG
GAGAAGGCTAAGATCGATGGCGATGAGGAGGCTATCAACAAAATGCTGGA
GAAGTTTCGCATAAATTCTCAAAACTAGCTCGGTGTCAAAAGTAATTATG
CATGCATTTCGTTTATTATATGCGACAATTTAACGTTTATTGTTTATTCA
CTTCACCCCAATAATAAATTATAACAAATTAAAAAAAAAAAAAAAAAAAA
AA

FI14102.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:37:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG12269-RA 602 CG12269-RA 117..550 1..434 2170 100 Plus
CG12269.a 742 CG12269.a 390..690 134..434 1505 100 Plus
CG12269.b 686 CG12269.b 390..686 134..430 1485 100 Plus
CG12269.a 742 CG12269.a 242..375 1..134 670 100 Plus
CG12269.b 686 CG12269.b 242..375 1..134 670 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:38:09
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 14802194..14802487 429..134 1400 99 Minus
chr3R 27901430 chr3R 14802562..14802695 134..1 655 99.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:24:31 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:38:07
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18978269..18978569 434..134 1505 100 Minus
3R 32079331 3R 18978644..18978777 134..1 670 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:54:07
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 18719100..18719400 434..134 1505 100 Minus
3R 31820162 3R 18719475..18719608 134..1 670 100 Minus
Blast to na_te.dros performed 2019-03-16 17:38:07
Subject Length Description Subject Range Query Range Score Percent Strand
rooA 7621 rooA ROOA_LTR 7621bp 6262..6318 287..342 111 70.7 Plus

FI14102.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:39:13 Download gff for FI14102.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 14802214..14802486 135..408 99 <- Minus
chr3R 14802562..14802695 1..134 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-03-24 14:38:50 Download gff for FI14102.complete
Subject Subject Range Query Range Percent Splice Strand
CG12269-RA 1..324 5..328 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:57:27 Download gff for FI14102.complete
Subject Subject Range Query Range Percent Splice Strand
CG12269-RA 1..324 5..328 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:36:09 Download gff for FI14102.complete
Subject Subject Range Query Range Percent Splice Strand
CG12269-RA 1..324 5..328 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:03:15 Download gff for FI14102.complete
Subject Subject Range Query Range Percent Splice Strand
CG12269-RA 1..324 5..328 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-03-24 14:38:49 Download gff for FI14102.complete
Subject Subject Range Query Range Percent Splice Strand
CG12269-RA 33..434 1..402 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:57:27 Download gff for FI14102.complete
Subject Subject Range Query Range Percent Splice Strand
CG12269-RA 33..434 1..402 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:36:09 Download gff for FI14102.complete
Subject Subject Range Query Range Percent Splice Strand
CG12269-RA 33..462 1..430 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:03:15 Download gff for FI14102.complete
Subject Subject Range Query Range Percent Splice Strand
CG12269-RA 33..462 1..430 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:39:13 Download gff for FI14102.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18978273..18978568 135..430 100 <- Minus
3R 18978644..18978777 1..134 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:39:13 Download gff for FI14102.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18978273..18978568 135..430 100 <- Minus
3R 18978644..18978777 1..134 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:39:13 Download gff for FI14102.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18978273..18978568 135..430 100 <- Minus
3R 18978644..18978777 1..134 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:36:09 Download gff for FI14102.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14803995..14804290 135..430 100 <- Minus
arm_3R 14804366..14804499 1..134 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:34:13 Download gff for FI14102.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18719104..18719399 135..430 100 <- Minus
3R 18719475..18719608 1..134 100   Minus

FI14102.hyp Sequence

Translation from 1 to 327

> FI14102.hyp
NMKSDEIIEKIRNKLKESDPARRTVVNTFQFNFTDADGNLIKSMALDIYE
GSATSVDAQVTISDEDFYLVGTKQKTFQEVLQQEKAKIDGDEEAINKMLE
KFRINSQN*

FI14102.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:16:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG12269-PA 107 CG12269-PA 1..107 2..108 533 100 Plus
CG12269-PB 112 CG12269-PB 1..112 2..108 517 95.5 Plus

FI14102.pep Sequence

Translation from 1 to 327

> FI14102.pep
NMKSDEIIEKIRNKLKESDPARRTVVNTFQFNFTDADGNLIKSMALDIYE
GSATSVDAQVTISDEDFYLVGTKQKTFQEVLQQEKAKIDGDEEAINKMLE
KFRINSQN*

FI14102.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 21:27:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23010-PA 107 GF23010-PA 1..107 2..108 519 93.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:27:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16262-PA 107 GG16262-PA 1..107 2..108 537 97.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 21:27:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17450-PA 107 GH17450-PA 1..107 2..108 465 81.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:33:33
Subject Length Description Subject Range Query Range Score Percent Strand
euc-PA 107 CG12269-PA 1..107 2..108 533 100 Plus
euc-PB 112 CG12269-PB 1..112 2..108 517 95.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 21:27:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22776-PA 107 GI22776-PA 1..106 2..107 460 80.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 21:27:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24106-PA 107 GL24106-PA 1..107 2..108 504 89.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 21:27:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11522-PA 107 GA11522-PA 1..107 2..108 507 90.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:27:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13649-PA 107 GM13649-PA 1..107 2..108 538 97.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:27:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20142-PA 107 GD20142-PA 1..107 2..108 511 91.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 21:27:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22778-PA 109 GJ22778-PA 1..106 2..107 451 79.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 21:27:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22434-PA 112 GK22434-PA 1..112 2..108 442 76.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:27:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25161-PA 107 GE25161-PA 1..107 2..108 537 97.2 Plus