Clone FI14105 Report

Search the DGRC for FI14105

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:141
Well:5
Vector:pOT2
Associated Gene/TranscriptCpr49Ag-RA
Protein status:FI14105.pep: gold
Sequenced Size:627

Clone Sequence Records

FI14105.complete Sequence

627 bp assembled on 2010-03-24

GenBank Submission: BT122117.1

> FI14105.complete
CAGGATATATACATCAACCCCCTTCGATATGTACAAGTTAGTCTTCCTCG
TCTGCTCCGCCCTGCTGCTCAGCTATGTCCTGGCCAGGCCACAGGATCAG
CGGGCGGGAGCCACCAGTGCAGCGACCACCACCACAGCTGCCACCATTGT
CAAGCAGGATAATGTGAACAACGCCGACGGTAGCTTCAACAGCAGCTATG
AGACATCGAACGGAATACGCGTAGAGAACATTGGCTATCTGAAGAAGATC
ATCGTTCCCAAGACCGAGACCTCCGATGGCCAGGTGATCGACGAACACGA
GGAGCTTGTACTGGTCCAGACCGGATCCTACAGCTACAGCGATCCCGATG
GCAATCTCATCACCCTGCGCTACGTGGCCGATGAGAACGGATTCCAGCCG
GAGGGTGACCATCTGCCGGTGGCACCTCAATAGTTTAACATATGTCCATA
GATGTCCATAGATGTCCATAGATGTCCCCTGTAATATTTCGCTTGAAAGT
ATTATGCACTGCCTGAATGCCATACGAAATTGAAATGTCTACATTCCGTA
GTTAGTCTTAAGCAAACACACACACACACACCGAAATAAATATTGGAAAC
GATAATGAAAAAAAAAAAAAAAAAAAA

FI14105.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:37:35
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr49Ag-RA 809 Cpr49Ag-RA 164..774 1..611 3055 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:26:49
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 8295351..8295764 194..607 2055 99.8 Plus
chr2R 21145070 chr2R 8295077..8295271 1..195 960 99.5 Plus
chr3L 24539361 chr3L 6140131..6140178 417..370 180 91.7 Minus
chr3L 24539361 chr3L 6143002..6143049 417..370 180 91.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:24:34 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:26:48
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12408110..12408527 194..611 2090 100 Plus
2R 25286936 2R 12407836..12408030 1..195 975 100 Plus
3L 28110227 3L 6147582..6147629 417..370 180 91.7 Minus
3L 28110227 3L 6150453..6150500 417..370 180 91.7 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:54:09
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12409309..12409726 194..611 2090 100 Plus
2R 25260384 2R 12409035..12409229 1..195 975 100 Plus
Blast to na_te.dros performed on 2019-03-16 18:26:48 has no hits.

FI14105.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:27:55 Download gff for FI14105.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 8295077..8295271 1..195 99 -> Plus
chr2R 8295353..8295764 196..607 91   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-03-24 15:05:40 Download gff for FI14105.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr49Ag-RA 1..405 29..433 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:57:29 Download gff for FI14105.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr49Ag-RA 1..405 29..433 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:19:47 Download gff for FI14105.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr49Ag-RA 1..405 29..433 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:39:42 Download gff for FI14105.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr49Ag-RA 1..405 29..433 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-03-24 15:05:40 Download gff for FI14105.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr49Ag-RA 1..607 1..607 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:57:29 Download gff for FI14105.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr49Ag-RA 1..607 1..607 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:19:47 Download gff for FI14105.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr49Ag-RA 44..650 1..607 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:39:42 Download gff for FI14105.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr49Ag-RA 44..650 1..607 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:27:55 Download gff for FI14105.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12407836..12408030 1..195 100 -> Plus
2R 12408112..12408523 196..607 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:27:55 Download gff for FI14105.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12407836..12408030 1..195 100 -> Plus
2R 12408112..12408523 196..607 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:27:55 Download gff for FI14105.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12407836..12408030 1..195 100 -> Plus
2R 12408112..12408523 196..607 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:19:47 Download gff for FI14105.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8295341..8295535 1..195 100 -> Plus
arm_2R 8295617..8296028 196..607 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:34:16 Download gff for FI14105.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12409311..12409722 196..607 100   Plus
2R 12409035..12409229 1..195 100 -> Plus

FI14105.hyp Sequence

Translation from 1 to 432

> FI14105.hyp
RIYTSTPFDMYKLVFLVCSALLLSYVLARPQDQRAGATSAATTTTAATIV
KQDNVNNADGSFNSSYETSNGIRVENIGYLKKIIVPKTETSDGQVIDEHE
ELVLVQTGSYSYSDPDGNLITLRYVADENGFQPEGDHLPVAPQ*

FI14105.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:26:32
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr49Ag-PA 134 CG8511-PA 1..134 10..143 682 100 Plus
Cpr49Aa-PB 144 CG30045-PB 3..112 11..142 216 42.4 Plus
Cpr49Ae-PA 134 CG8505-PA 30..112 49..142 215 49.5 Plus
Cpr65Az-PA 239 CG12330-PA 116..196 49..142 209 44.7 Plus
Cpr47Ea-PA 135 CG9079-PA 11..122 16..142 206 39.4 Plus

FI14105.pep Sequence

Translation from 1 to 432

> FI14105.pep
RIYTSTPFDMYKLVFLVCSALLLSYVLARPQDQRAGATSAATTTTAATIV
KQDNVNNADGSFNSSYETSNGIRVENIGYLKKIIVPKTETSDGQVIDEHE
ELVLVQTGSYSYSDPDGNLITLRYVADENGFQPEGDHLPVAPQ*

FI14105.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 21:26:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12859-PA 133 GF12859-PA 1..133 10..143 603 91.8 Plus
Dana\GF12857-PA 134 GF12857-PA 1..108 10..138 209 40.8 Plus
Dana\GF12852-PA 141 GF12852-PA 1..103 10..138 195 39.5 Plus
Dana\GF23528-PA 253 GF23528-PA 130..206 49..138 190 45.7 Plus
Dana\GF12427-PA 135 GF12427-PA 2..118 7..138 184 38.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:26:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20295-PA 134 GG20295-PA 1..134 10..143 637 94.8 Plus
Dere\GG22686-PA 135 GG22686-PA 11..122 16..142 205 40.6 Plus
Dere\GG20286-PA 326 GG20286-PA 124..256 5..138 205 36.6 Plus
Dere\GG20293-PA 134 GG20293-PA 1..108 10..138 204 39.2 Plus
Dere\GG15329-PA 234 GG15329-PA 111..187 49..138 189 44.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 21:26:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20700-PA 134 GH20700-PA 1..134 10..143 579 85.1 Plus
Dgri\GH20692-PA 142 GH20692-PA 2..105 12..138 199 38.6 Plus
Dgri\GH15839-PA 245 GH15839-PA 122..198 49..138 196 47.8 Plus
Dgri\GH21943-PA 175 GH21943-PA 54..157 17..138 195 44 Plus
Dgri\GH20698-PA 136 GH20698-PA 1..109 10..138 184 38.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:25:35
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr49Ag-PA 134 CG8511-PA 1..134 10..143 682 100 Plus
Cpr49Aa-PB 144 CG30045-PB 3..112 11..142 216 42.4 Plus
Cpr49Ae-PA 134 CG8505-PA 30..112 49..142 215 49.5 Plus
Cpr65Az-PA 239 CG12330-PA 116..196 49..142 209 44.7 Plus
Cpr47Ea-PA 135 CG9079-PA 11..122 16..142 206 39.4 Plus
Cpr49Ah-PA 190 CG8515-PA 47..133 43..142 191 40 Plus
Cpr65Av-PA 111 CG32405-PA 8..109 14..139 176 36.5 Plus
Cpr78Cc-PA 119 CG7658-PA 1..99 10..142 174 34.8 Plus
Cpr47Ee-PA 369 CG13222-PA 107..189 49..143 164 40 Plus
Cpr47Ef-PD 601 CG13214-PD 141..215 54..142 160 38.2 Plus
Cpr47Ef-PC 612 CG13214-PC 141..215 54..142 160 38.2 Plus
Cpr65Ax2-PB 102 CG18777-PB 25..100 68..142 154 40.8 Plus
Cpr65Ax2-PA 102 CG18777-PA 25..100 68..142 154 40.8 Plus
Cpr65Ax1-PA 102 CG34270-PA 25..100 68..142 154 40.8 Plus
Lcp65Af-PA 100 CG10533-PA 31..98 61..142 145 40.2 Plus
Cpr11B-PB 195 CG2555-PB 72..150 49..142 144 37.2 Plus
Cpr11B-PA 197 CG2555-PA 72..150 49..142 144 37.2 Plus
Lcp65Ac-PA 109 CG6956-PA 40..106 62..142 143 40.7 Plus
Cpr65Aw-PA 117 CG32404-PA 19..104 40..139 141 37 Plus
Lcp65Ag3-PA 105 CG18779-PA 16..103 40..142 137 35 Plus
Acp65Aa-PA 105 CG10297-PA 1..104 10..139 136 32.1 Plus
Cpr67Fb-PA 122 CG18348-PA 1..97 16..142 136 35.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 21:26:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19060-PA 133 GI19060-PA 1..133 10..143 559 85.1 Plus
Dmoj\GI12621-PA 253 GI12621-PA 135..211 49..138 208 47.8 Plus
Dmoj\GI19053-PA 141 GI19053-PA 2..105 12..138 206 39.4 Plus
Dmoj\GI19650-PA 136 GI19650-PA 7..118 14..138 200 41.3 Plus
Dmoj\GI19063-PA 196 GI19063-PA 47..140 29..142 184 38.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 21:26:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11636-PA 134 GL11636-PA 1..134 10..143 514 78.4 Plus
Dper\GL11629-PA 149 GL11629-PA 8..112 11..138 213 41.9 Plus
Dper\GL11634-PA 134 GL11634-PA 1..108 10..138 210 42.3 Plus
Dper\GL24679-PA 120 GL24679-PA 1..99 10..142 186 36.6 Plus
Dper\GL11640-PA 192 GL11640-PA 49..135 43..142 183 40 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 21:26:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21129-PA 201 GA21129-PA 65..201 7..143 616 88.3 Plus
Dpse\GA15602-PA 149 GA15602-PA 8..112 11..138 205 40.3 Plus
Dpse\GA21125-PA 121 GA21125-PA 17..95 49..138 203 49.5 Plus
Dpse\GA11560-PA 248 GA11560-PA 129..205 49..138 192 46.7 Plus
Dpse\GA21525-PA 136 GA21525-PA 1..119 10..138 185 39.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:26:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21382-PA 134 GM21382-PA 1..134 10..143 676 97 Plus
Dsec\GM21380-PA 134 GM21380-PA 1..108 10..138 206 39.2 Plus
Dsec\GM14766-PA 239 GM14766-PA 116..192 49..138 191 44.4 Plus
Dsec\GM21386-PA 190 GM21386-PA 47..133 43..142 182 40 Plus
Dsec\GM13864-PA 111 GM13864-PA 7..109 13..139 176 35.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:26:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10879-PA 134 GD10879-PA 1..134 10..143 676 97 Plus
Dsim\GD10877-PA 134 GD10877-PA 1..108 10..138 206 39.2 Plus
Dsim\GD10883-PA 190 GD10883-PA 47..133 43..142 182 40 Plus
Dsim\GD10870-PA 267 GD10870-PA 156..231 49..138 179 46.7 Plus
Dsim\GD13147-PA 111 GD13147-PA 7..109 13..139 176 35.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 21:26:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20030-PA 133 GJ20030-PA 1..133 10..143 567 85.8 Plus
Dvir\GJ12743-PA 255 GJ12743-PA 133..213 49..142 215 47.9 Plus
Dvir\GJ20022-PA 173 GJ20022-PA 37..137 15..138 198 40.3 Plus
Dvir\GJ15017-PA 137 GJ15017-PA 18..118 23..138 194 43.1 Plus
Dvir\GJ20034-PA 305 GJ20034-PA 162..248 43..142 185 40 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 21:26:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22933-PA 133 GK22933-PA 1..133 10..143 495 74.1 Plus
Dwil\GK22931-PA 134 GK22931-PA 1..108 10..138 214 41.5 Plus
Dwil\GK16922-PA 108 GK16922-PA 1..106 13..142 199 38.5 Plus
Dwil\GK20648-PA 137 GK20648-PA 1..123 10..142 195 38.7 Plus
Dwil\GK16920-PA 111 GK16920-PA 4..109 8..139 178 36.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:26:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12455-PA 134 GE12455-PA 1..134 10..143 682 96.3 Plus
Dyak\GE12453-PA 134 GE12453-PA 1..108 10..138 205 39.2 Plus
Dyak\GE21547-PA 238 GE21547-PA 115..191 49..138 193 45.6 Plus
Dyak\GE13041-PA 135 GE13041-PA 11..118 16..138 191 40.3 Plus
Dyak\GE12460-PA 190 GE12460-PA 47..133 43..142 182 40 Plus