BDGP Sequence Production Resources |
Search the DGRC for FI14106
Library: | FI |
Tissue Source: | various Drosophila melanogaster |
Created by: | |
Date Registered: | 2005-11-08 |
Comments: | Drosophila melanogaster corrected cDNA clones |
Original Plate Number: | 141 |
Well: | 6 |
Vector: | pOT2 |
Associated Gene/Transcript | CG16836-RA |
Protein status: | FI14106.pep: gold |
Sequenced Size: | 302 |
302 bp assembled on 2010-03-24
GenBank Submission: BT122113.1
> FI14106.complete AAAACATGAAAGCTCTTCAAGTCGCCGGAACTTTGATGCTGCTTTTCTGC CTGCTGGCAGCTGTTAATGCTACGCCGGGACAAGTGTATATCAATGGGAA ATGCATTGACTGCAATAAGCCTGATAATGATCCGGGAATTATAATTCCTC CAGACCATAAATCAGCTGGATCCATGTCTTACACACTCACATCTGGAGCC ATCTTCTTTGGAATTATATATCATATATTCAGTTAAATTACTATGTAATC AATAAGTTAATAAAATAATATCTTTTATTTCTCAAAAAAAAAAAAAAAAA AA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG16836-RA | 483 | CG16836-RA | 146..437 | 1..292 | 1460 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 14276136..14276204 | 1..69 | 95 | -> | Plus |
chr2R | 14276273..14276486 | 70..283 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG16836-RA | 1..231 | 6..236 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG16836-RA | 1..231 | 6..236 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG16836-RA | 1..231 | 6..236 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG16836-RA | 1..231 | 6..236 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG16836-RA | 1..283 | 1..283 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG16836-RA | 1..283 | 1..283 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG16836-RA | 101..383 | 1..283 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG16836-RA | 101..383 | 1..283 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 18389095..18389163 | 1..69 | 100 | -> | Plus |
2R | 18389230..18389443 | 70..283 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 18389095..18389163 | 1..69 | 100 | -> | Plus |
2R | 18389230..18389443 | 70..283 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 18389095..18389163 | 1..69 | 100 | -> | Plus |
2R | 18389230..18389443 | 70..283 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 14276600..14276668 | 1..69 | 100 | -> | Plus |
arm_2R | 14276735..14276948 | 70..283 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 18390429..18390642 | 70..283 | 100 | Plus | |
2R | 18390294..18390362 | 1..69 | 100 | -> | Plus |
Translation from 2 to 235
> FI14106.hyp NMKALQVAGTLMLLFCLLAAVNATPGQVYINGKCIDCNKPDNDPGIIIPP DHKSAGSMSYTLTSGAIFFGIIYHIFS*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG16836-PA | 76 | CG16836-PA | 1..76 | 2..77 | 402 | 100 | Plus |
Translation from 2 to 235
> FI14106.pep NMKALQVAGTLMLLFCLLAAVNATPGQVYINGKCIDCNKPDNDPGIIIPP DHKSAGSMSYTLTSGAIFFGIIYHIFS*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF12157-PA | 78 | GF12157-PA | 1..74 | 2..77 | 266 | 68.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG21878-PA | 76 | GG21878-PA | 1..76 | 2..77 | 368 | 93.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH21664-PA | 79 | GH21664-PA | 16..74 | 19..77 | 169 | 50.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG16836-PA | 76 | CG16836-PA | 1..76 | 2..77 | 402 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI20117-PA | 74 | GI20117-PA | 18..70 | 21..77 | 150 | 52.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL17766-PA | 75 | GL17766-PA | 1..75 | 2..77 | 206 | 61.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA24905-PB | 114 | GA24905-PB | 39..114 | 1..77 | 208 | 61 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21871-PA | 76 | GM21871-PA | 1..76 | 2..77 | 359 | 90.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11367-PA | 76 | GD11367-PA | 1..76 | 2..77 | 354 | 88.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ19888-PA | 82 | GJ19888-PA | 16..74 | 19..77 | 183 | 55.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE11952-PA | 76 | GE11952-PA | 1..75 | 2..76 | 325 | 81.3 | Plus |