Clone FI14106 Report

Search the DGRC for FI14106

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:141
Well:6
Vector:pOT2
Associated Gene/TranscriptCG16836-RA
Protein status:FI14106.pep: gold
Sequenced Size:302

Clone Sequence Records

FI14106.complete Sequence

302 bp assembled on 2010-03-24

GenBank Submission: BT122113.1

> FI14106.complete
AAAACATGAAAGCTCTTCAAGTCGCCGGAACTTTGATGCTGCTTTTCTGC
CTGCTGGCAGCTGTTAATGCTACGCCGGGACAAGTGTATATCAATGGGAA
ATGCATTGACTGCAATAAGCCTGATAATGATCCGGGAATTATAATTCCTC
CAGACCATAAATCAGCTGGATCCATGTCTTACACACTCACATCTGGAGCC
ATCTTCTTTGGAATTATATATCATATATTCAGTTAAATTACTATGTAATC
AATAAGTTAATAAAATAATATCTTTTATTTCTCAAAAAAAAAAAAAAAAA
AA

FI14106.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:37:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG16836-RA 483 CG16836-RA 146..437 1..292 1460 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:19:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 14276272..14276486 69..283 1060 99.5 Plus
chr2R 21145070 chr2R 14276136..14276204 1..69 300 95.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:24:35 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:19:26
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18389229..18389452 69..292 1120 100 Plus
2R 25286936 2R 18389095..18389163 1..69 345 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:54:06
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18390428..18390651 69..292 1120 100 Plus
2R 25260384 2R 18390294..18390362 1..69 345 100 Plus
Blast to na_te.dros performed on 2019-03-16 15:19:26 has no hits.

FI14106.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:20:04 Download gff for FI14106.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 14276136..14276204 1..69 95 -> Plus
chr2R 14276273..14276486 70..283 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-03-24 14:38:52 Download gff for FI14106.complete
Subject Subject Range Query Range Percent Splice Strand
CG16836-RA 1..231 6..236 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:57:24 Download gff for FI14106.complete
Subject Subject Range Query Range Percent Splice Strand
CG16836-RA 1..231 6..236 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:43:11 Download gff for FI14106.complete
Subject Subject Range Query Range Percent Splice Strand
CG16836-RA 1..231 6..236 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:44:28 Download gff for FI14106.complete
Subject Subject Range Query Range Percent Splice Strand
CG16836-RA 1..231 6..236 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-03-24 14:38:52 Download gff for FI14106.complete
Subject Subject Range Query Range Percent Splice Strand
CG16836-RA 1..283 1..283 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:57:24 Download gff for FI14106.complete
Subject Subject Range Query Range Percent Splice Strand
CG16836-RA 1..283 1..283 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:43:11 Download gff for FI14106.complete
Subject Subject Range Query Range Percent Splice Strand
CG16836-RA 101..383 1..283 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:44:28 Download gff for FI14106.complete
Subject Subject Range Query Range Percent Splice Strand
CG16836-RA 101..383 1..283 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:20:04 Download gff for FI14106.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18389095..18389163 1..69 100 -> Plus
2R 18389230..18389443 70..283 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:20:04 Download gff for FI14106.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18389095..18389163 1..69 100 -> Plus
2R 18389230..18389443 70..283 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:20:04 Download gff for FI14106.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18389095..18389163 1..69 100 -> Plus
2R 18389230..18389443 70..283 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:43:11 Download gff for FI14106.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14276600..14276668 1..69 100 -> Plus
arm_2R 14276735..14276948 70..283 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:34:10 Download gff for FI14106.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18390429..18390642 70..283 100   Plus
2R 18390294..18390362 1..69 100 -> Plus

FI14106.hyp Sequence

Translation from 2 to 235

> FI14106.hyp
NMKALQVAGTLMLLFCLLAAVNATPGQVYINGKCIDCNKPDNDPGIIIPP
DHKSAGSMSYTLTSGAIFFGIIYHIFS*

FI14106.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:42:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG16836-PA 76 CG16836-PA 1..76 2..77 402 100 Plus

FI14106.pep Sequence

Translation from 2 to 235

> FI14106.pep
NMKALQVAGTLMLLFCLLAAVNATPGQVYINGKCIDCNKPDNDPGIIIPP
DHKSAGSMSYTLTSGAIFFGIIYHIFS*

FI14106.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 21:27:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12157-PA 78 GF12157-PA 1..74 2..77 266 68.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:27:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21878-PA 76 GG21878-PA 1..76 2..77 368 93.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 21:27:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21664-PA 79 GH21664-PA 16..74 19..77 169 50.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:55:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG16836-PA 76 CG16836-PA 1..76 2..77 402 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 21:27:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20117-PA 74 GI20117-PA 18..70 21..77 150 52.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 21:27:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17766-PA 75 GL17766-PA 1..75 2..77 206 61.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 21:27:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24905-PB 114 GA24905-PB 39..114 1..77 208 61 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:27:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21871-PA 76 GM21871-PA 1..76 2..77 359 90.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:27:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11367-PA 76 GD11367-PA 1..76 2..77 354 88.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 21:27:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19888-PA 82 GJ19888-PA 16..74 19..77 183 55.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:27:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11952-PA 76 GE11952-PA 1..75 2..76 325 81.3 Plus