Clone FI14109 Report

Search the DGRC for FI14109

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:141
Well:9
Vector:pOT2
Associated Gene/TranscriptCG4186-RA
Protein status:FI14109.pep: gold
Sequenced Size:404

Clone Sequence Records

FI14109.complete Sequence

404 bp assembled on 2010-03-24

GenBank Submission: BT122118.1

> FI14109.complete
AAACAATCCCGTTTTTACATAAGTTTAATTTAAACATTTTCATTCAATAA
AACAAATGCCTCGCAATCAAAACGCAGAGCAGGATAATCCCTGCCTAAAG
GAACAGGAGCTTTCATTTAAATGCCTCAACAAAAACAACTTTGATCGCGA
CAAGTGCGAAATATATTTTGCCAATTATAACAATTGCAAGGAGTTCTGGA
ACAAAGTAAAAACCGAAAGGAGAGCCAAGGGAATAGCTCCTTATTTGCCG
CCCTTAGAAGAACGCGATGGGATTAAAGCAGAATATATGAAAGGAAAACC
CCAACAAAGCTGATAAATGTATCTTCCTATTTAATTATTTTGTGTATATA
AATTAGCTATACATCAGGCACCAAAGCTTGCACAAGAAAAAAAAAAAAAA
AAAA

FI14109.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:37:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG4186-RA 462 CG4186-RA 19..404 1..386 1930 100 Plus
CG4074-RA 1458 CG4074-RA 98..198 101..1 505 100 Minus
CG4074.a 1458 CG4074.a 98..198 101..1 505 100 Minus
CG4074-RA 1458 CG4074-RA 1..47 145..99 235 100 Minus
CG4074.a 1458 CG4074.a 1..47 145..99 235 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:47:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 20758915..20759102 199..386 940 100 Plus
chr3L 24539361 chr3L 20758608..20758708 1..101 505 100 Plus
chr3L 24539361 chr3L 20758759..20758859 99..199 505 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:24:36 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:47:36
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 20769893..20770080 199..386 940 100 Plus
3L 28110227 3L 20769586..20769686 1..101 505 100 Plus
3L 28110227 3L 20769737..20769837 99..199 505 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:54:09
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 20762993..20763180 199..386 940 100 Plus
3L 28103327 3L 20762837..20762937 99..199 505 100 Plus
3L 28103327 3L 20762686..20762786 1..101 505 100 Plus
Blast to na_te.dros performed 2019-03-16 10:47:36
Subject Length Description Subject Range Query Range Score Percent Strand
X-element 4740 X-element ROXELEMENT 4740bp 152..186 22..56 112 80 Plus

FI14109.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:48:32 Download gff for FI14109.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 20758608..20758707 1..100 100 -> Plus
chr3L 20758761..20758859 101..199 100 -> Plus
chr3L 20758916..20759102 200..386 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-03-24 15:05:39 Download gff for FI14109.complete
Subject Subject Range Query Range Percent Splice Strand
CG4186-RA 1..258 56..313 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:57:31 Download gff for FI14109.complete
Subject Subject Range Query Range Percent Splice Strand
CG4186-RA 1..258 56..313 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:58:26 Download gff for FI14109.complete
Subject Subject Range Query Range Percent Splice Strand
CG4186-RA 1..258 56..313 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:16:42 Download gff for FI14109.complete
Subject Subject Range Query Range Percent Splice Strand
CG4186-RA 1..258 56..313 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-03-24 15:05:38 Download gff for FI14109.complete
Subject Subject Range Query Range Percent Splice Strand
CG4186-RA 1..386 1..386 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:57:30 Download gff for FI14109.complete
Subject Subject Range Query Range Percent Splice Strand
CG4186-RA 1..386 1..386 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:58:26 Download gff for FI14109.complete
Subject Subject Range Query Range Percent Splice Strand
CG4186-RA 1..386 1..386 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:16:42 Download gff for FI14109.complete
Subject Subject Range Query Range Percent Splice Strand
CG4186-RA 1..386 1..386 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:48:32 Download gff for FI14109.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20769586..20769685 1..100 100 -> Plus
3L 20769739..20769837 101..199 100 -> Plus
3L 20769894..20770080 200..386 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:48:32 Download gff for FI14109.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20769586..20769685 1..100 100 -> Plus
3L 20769739..20769837 101..199 100 -> Plus
3L 20769894..20770080 200..386 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:48:32 Download gff for FI14109.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20769586..20769685 1..100 100 -> Plus
3L 20769739..20769837 101..199 100 -> Plus
3L 20769894..20770080 200..386 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:58:26 Download gff for FI14109.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 20762686..20762785 1..100 100 -> Plus
arm_3L 20762839..20762937 101..199 100 -> Plus
arm_3L 20762994..20763180 200..386 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:34:17 Download gff for FI14109.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20762686..20762785 1..100 100 -> Plus
3L 20762839..20762937 101..199 100 -> Plus
3L 20762994..20763180 200..386 100   Plus

FI14109.hyp Sequence

Translation from 55 to 312

> FI14109.hyp
MPRNQNAEQDNPCLKEQELSFKCLNKNNFDRDKCEIYFANYNNCKEFWNK
VKTERRAKGIAPYLPPLEERDGIKAEYMKGKPQQS*

FI14109.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:28:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG4186-PB 85 CG4186-PB 1..85 1..85 472 100 Plus
CG4186-PA 85 CG4186-PA 1..85 1..85 472 100 Plus

FI14109.pep Sequence

Translation from 55 to 312

> FI14109.pep
MPRNQNAEQDNPCLKEQELSFKCLNKNNFDRDKCEIYFANYNNCKEFWNK
VKTERRAKGIAPYLPPLEERDGIKAEYMKGKPQQS*

FI14109.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 21:27:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20117-PA 85 GF20117-PA 1..85 1..85 420 91.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:27:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16134-PA 85 GG16134-PA 1..85 1..85 417 94.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 21:27:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14781-PA 85 GH14781-PA 1..84 1..84 369 79.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:11:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG4186-PB 85 CG4186-PB 1..85 1..85 472 100 Plus
CG4186-PA 85 CG4186-PA 1..85 1..85 472 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 21:27:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11883-PA 84 GI11883-PA 1..83 1..83 376 83.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 21:27:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12810-PA 85 GL12810-PA 1..85 1..85 401 87.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 21:27:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18014-PA 85 GA18014-PA 1..85 1..85 401 87.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:27:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22317-PA 85 GM22317-PA 1..85 1..85 432 96.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:27:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14905-PA 82 GD14905-PA 1..82 1..85 390 90.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 21:27:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13762-PA 85 GJ13762-PA 1..85 1..85 382 82.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 21:27:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10506-PA 86 GK10506-PA 1..85 1..85 393 83.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:27:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23244-PA 85 GE23244-PA 1..85 1..85 418 94.1 Plus
Dyak\GE19701-PA 85 GE19701-PA 1..85 1..85 418 94.1 Plus