BDGP Sequence Production Resources |
Search the DGRC for FI14109
Library: | FI |
Tissue Source: | various Drosophila melanogaster |
Created by: | |
Date Registered: | 2005-11-08 |
Comments: | Drosophila melanogaster corrected cDNA clones |
Original Plate Number: | 141 |
Well: | 9 |
Vector: | pOT2 |
Associated Gene/Transcript | CG4186-RA |
Protein status: | FI14109.pep: gold |
Sequenced Size: | 404 |
404 bp assembled on 2010-03-24
GenBank Submission: BT122118.1
> FI14109.complete AAACAATCCCGTTTTTACATAAGTTTAATTTAAACATTTTCATTCAATAA AACAAATGCCTCGCAATCAAAACGCAGAGCAGGATAATCCCTGCCTAAAG GAACAGGAGCTTTCATTTAAATGCCTCAACAAAAACAACTTTGATCGCGA CAAGTGCGAAATATATTTTGCCAATTATAACAATTGCAAGGAGTTCTGGA ACAAAGTAAAAACCGAAAGGAGAGCCAAGGGAATAGCTCCTTATTTGCCG CCCTTAGAAGAACGCGATGGGATTAAAGCAGAATATATGAAAGGAAAACC CCAACAAAGCTGATAAATGTATCTTCCTATTTAATTATTTTGTGTATATA AATTAGCTATACATCAGGCACCAAAGCTTGCACAAGAAAAAAAAAAAAAA AAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG4186-RA | 462 | CG4186-RA | 19..404 | 1..386 | 1930 | 100 | Plus |
CG4074-RA | 1458 | CG4074-RA | 98..198 | 101..1 | 505 | 100 | Minus |
CG4074.a | 1458 | CG4074.a | 98..198 | 101..1 | 505 | 100 | Minus |
CG4074-RA | 1458 | CG4074-RA | 1..47 | 145..99 | 235 | 100 | Minus |
CG4074.a | 1458 | CG4074.a | 1..47 | 145..99 | 235 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 20758915..20759102 | 199..386 | 940 | 100 | Plus |
chr3L | 24539361 | chr3L | 20758608..20758708 | 1..101 | 505 | 100 | Plus |
chr3L | 24539361 | chr3L | 20758759..20758859 | 99..199 | 505 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
X-element | 4740 | X-element ROXELEMENT 4740bp | 152..186 | 22..56 | 112 | 80 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 20758608..20758707 | 1..100 | 100 | -> | Plus |
chr3L | 20758761..20758859 | 101..199 | 100 | -> | Plus |
chr3L | 20758916..20759102 | 200..386 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4186-RA | 1..258 | 56..313 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4186-RA | 1..258 | 56..313 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4186-RA | 1..258 | 56..313 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4186-RA | 1..258 | 56..313 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4186-RA | 1..386 | 1..386 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4186-RA | 1..386 | 1..386 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4186-RA | 1..386 | 1..386 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4186-RA | 1..386 | 1..386 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 20769586..20769685 | 1..100 | 100 | -> | Plus |
3L | 20769739..20769837 | 101..199 | 100 | -> | Plus |
3L | 20769894..20770080 | 200..386 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 20769586..20769685 | 1..100 | 100 | -> | Plus |
3L | 20769739..20769837 | 101..199 | 100 | -> | Plus |
3L | 20769894..20770080 | 200..386 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 20769586..20769685 | 1..100 | 100 | -> | Plus |
3L | 20769739..20769837 | 101..199 | 100 | -> | Plus |
3L | 20769894..20770080 | 200..386 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 20762686..20762785 | 1..100 | 100 | -> | Plus |
arm_3L | 20762839..20762937 | 101..199 | 100 | -> | Plus |
arm_3L | 20762994..20763180 | 200..386 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 20762686..20762785 | 1..100 | 100 | -> | Plus |
3L | 20762839..20762937 | 101..199 | 100 | -> | Plus |
3L | 20762994..20763180 | 200..386 | 100 | Plus |
Translation from 55 to 312
> FI14109.hyp MPRNQNAEQDNPCLKEQELSFKCLNKNNFDRDKCEIYFANYNNCKEFWNK VKTERRAKGIAPYLPPLEERDGIKAEYMKGKPQQS*
Translation from 55 to 312
> FI14109.pep MPRNQNAEQDNPCLKEQELSFKCLNKNNFDRDKCEIYFANYNNCKEFWNK VKTERRAKGIAPYLPPLEERDGIKAEYMKGKPQQS*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF20117-PA | 85 | GF20117-PA | 1..85 | 1..85 | 420 | 91.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG16134-PA | 85 | GG16134-PA | 1..85 | 1..85 | 417 | 94.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH14781-PA | 85 | GH14781-PA | 1..84 | 1..84 | 369 | 79.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG4186-PB | 85 | CG4186-PB | 1..85 | 1..85 | 472 | 100 | Plus |
CG4186-PA | 85 | CG4186-PA | 1..85 | 1..85 | 472 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI11883-PA | 84 | GI11883-PA | 1..83 | 1..83 | 376 | 83.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL12810-PA | 85 | GL12810-PA | 1..85 | 1..85 | 401 | 87.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA18014-PA | 85 | GA18014-PA | 1..85 | 1..85 | 401 | 87.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM22317-PA | 85 | GM22317-PA | 1..85 | 1..85 | 432 | 96.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14905-PA | 82 | GD14905-PA | 1..82 | 1..85 | 390 | 90.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ13762-PA | 85 | GJ13762-PA | 1..85 | 1..85 | 382 | 82.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK10506-PA | 86 | GK10506-PA | 1..85 | 1..85 | 393 | 83.5 | Plus |