Clone FI14118 Report

Search the DGRC for FI14118

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:141
Well:18
Vector:pOT2
Associated Gene/TranscriptHSPC300-RA
Protein status:FI14118.pep: gold
Sequenced Size:339

Clone Sequence Records

FI14118.complete Sequence

339 bp assembled on 2010-03-25

GenBank Submission: BT122128.1

> FI14118.complete
AAACAATAGGAATAAATAAAGATGAGTGGGGCTCACAGAGAGGCGATCCA
AAAGCAGATCCACCAGGACTGGGCGAACAGGGAGTATATCGAAGTGATAA
CTGCCAGCATAAAGAGAATCACCGACTTTCTGAACTCTTTCGATATGTCC
TGTCGCTCCCGTCTGGCGGTGCTGAACGAAAAACTAACGATCCTGGAGCG
GCGCATAGACTATCTGGAGGCGTGCGTCGCCCAGGGTGAAACATTAACGT
AAACGCTGCCCACAACCTTATACTAAGCTTTGTACATTTATAAGTAATTA
AAATACTGATTTAATAAAAAAAAAAAAAAAAAAAAAAAA

FI14118.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:37:44
Subject Length Description Subject Range Query Range Score Percent Strand
HSPC300-RA 633 HSPC300-RA 84..399 1..316 1580 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:47:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19914025..19914198 315..142 855 99.4 Minus
chr2R 21145070 chr2R 19914686..19914827 142..1 710 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:24:37 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:47:39
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24027951..24028125 316..142 875 100 Minus
2R 25286936 2R 24028614..24028755 142..1 710 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:54:16
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 24029150..24029324 316..142 875 100 Minus
2R 25260384 2R 24029813..24029954 142..1 710 100 Minus
Blast to na_te.dros performed 2019-03-16 10:47:39
Subject Length Description Subject Range Query Range Score Percent Strand
S-element 1736 S-element DM33463 1736bp Derived from U33463 (g1006788) (Rel. 47, Last updated, Version 5). 112..147 315..279 101 78.4 Minus
S-element 1736 S-element DM33463 1736bp Derived from U33463 (g1006788) (Rel. 47, Last updated, Version 5). 1590..1625 279..315 101 78.4 Plus

FI14118.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:48:33 Download gff for FI14118.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19914686..19914827 1..142 100   Minus
chr2R 19914025..19914197 143..315 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-03-25 10:20:10 Download gff for FI14118.complete
Subject Subject Range Query Range Percent Splice Strand
SIP1-RA 1..231 22..252 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:57:43 Download gff for FI14118.complete
Subject Subject Range Query Range Percent Splice Strand
HSPC300-RA 1..231 22..252 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:59:03 Download gff for FI14118.complete
Subject Subject Range Query Range Percent Splice Strand
HSPC300-RA 1..231 22..252 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:16:45 Download gff for FI14118.complete
Subject Subject Range Query Range Percent Splice Strand
HSPC300-RA 1..231 22..252 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-03-25 10:20:08 Download gff for FI14118.complete
Subject Subject Range Query Range Percent Splice Strand
SIP1-RA 48..362 1..315 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:57:43 Download gff for FI14118.complete
Subject Subject Range Query Range Percent Splice Strand
HSPC300-RA 48..362 1..315 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:59:03 Download gff for FI14118.complete
Subject Subject Range Query Range Percent Splice Strand
HSPC300-RA 35..349 1..315 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:16:45 Download gff for FI14118.complete
Subject Subject Range Query Range Percent Splice Strand
HSPC300-RA 35..349 1..315 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:48:33 Download gff for FI14118.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24028614..24028755 1..142 100   Minus
2R 24027952..24028124 143..315 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:48:33 Download gff for FI14118.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24028614..24028755 1..142 100   Minus
2R 24027952..24028124 143..315 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:48:33 Download gff for FI14118.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24028614..24028755 1..142 100   Minus
2R 24027952..24028124 143..315 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:59:03 Download gff for FI14118.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19915475..19915647 143..315 100 <- Minus
arm_2R 19916137..19916278 1..142 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:34:32 Download gff for FI14118.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24029169..24029341 143..315 100 <- Minus
2R 24029831..24029972 1..142 100   Minus

FI14118.hyp Sequence

Translation from 2 to 238

> FI14118.hyp
TIGINKDEWGSQRGDPKADPPGLGEQGVYRSDNCQHKENHRLSELFRYVL
SLPSGGAERKTNDPGAAHRLSGGVRRPG*
Sequence FI14118.hyp has no blast hits.

FI14118.pep Sequence

Translation from 21 to 251

> FI14118.pep
MSGAHREAIQKQIHQDWANREYIEVITASIKRITDFLNSFDMSCRSRLAV
LNEKLTILERRIDYLEACVAQGETLT*

FI14118.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:02:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12040-PA 76 GF12040-PA 1..76 1..76 399 100 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:02:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19964-PA 76 GG19964-PA 1..76 1..76 399 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 18:02:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20169-PA 76 GH20169-PA 1..76 1..76 394 97.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:07:48
Subject Length Description Subject Range Query Range Score Percent Strand
HSPC300-PB 76 CG30173-PB 1..76 1..76 385 100 Plus
HSPC300-PA 76 CG30173-PA 1..76 1..76 385 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 18:02:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20687-PA 76 GI20687-PA 1..76 1..76 388 94.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 18:02:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10432-PA 76 GL10432-PA 1..76 1..76 399 100 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 18:02:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15698-PA 76 GA15698-PA 1..76 1..76 399 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:02:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18284-PA 76 GM18284-PA 1..76 1..76 399 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:02:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17870-PA 35 GD17870-PA 1..35 42..76 177 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 18:02:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21896-PA 76 GJ21896-PA 1..76 1..76 389 96.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 18:02:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21927-PA 76 GK21927-PA 1..76 1..76 390 97.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:02:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11496-PA 76 GE11496-PA 1..76 1..76 399 100 Plus