Clone FI14123 Report

Search the DGRC for FI14123

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:141
Well:23
Vector:pOT2
Associated Gene/TranscriptCG33474-RA
Protein status:FI14123.pep: gold
Sequenced Size:800

Clone Sequence Records

FI14123.complete Sequence

800 bp assembled on 2010-03-24

GenBank Submission: BT122120.1

> FI14123.complete
TAGCATACAATTATGGCAAAGTTTATAAATGAGATCGGTGAACTTCTTGA
TTCCTGTAGAGCCCGAGAGGTTTTGATGGAGGTATTATGCCAAAGTGCCC
AATTGGTAATAGGATACCAAATCAATCAGAGTCCAGACCTAAACAATGTG
GGTTCAGAAGACTCTGGGGAGCCACCTGTGCTTCGGTACACTGTGGACAG
CGAACTGCACGACTATGAACCAGATCGCATTACGGCTCTATTGACGGTGA
TGTCAAATACGGTGGATCTGCTTTTCTATCCCGTAGACACCATTTGCTGG
CTGGCCAGTCACAAAGTTTTCGATGTCAAAAAACAGAAGACCTGGCGCTT
TGTGAACTCGTTACTCAGCATGGTCTCTGCATACCTAAACGTCGTGAGAA
TTTCAAGAATTTTCTTACAAGATGGCTATAAACTAAGTCACTTCGATGTT
GTGTCCCTTGCACACTTTTTATTCGATCTGCTTCACAACATCTGCAGTTT
ACCAAGGAGTTACCTGTGGGGCATGAAGCATTCATCCCTTTACTTGGGAG
TTATTGGCACCGTTTCTGCTGGACTGGGAATTTGCCAGATTTTGACCAAA
AGAAGGCTGACCAAGTAGAAGGTTTTGCCATTGATGCTGATTTTGGTGAA
TGAAATTTGAAGATAGTCGTTATCGTATTTTTGGCGTGGTGATATTGATA
AGACATTTGAATGAGCCTCTAGTTGGCATTCGTTTTATAAGTACAATAAA
AATAGTTTGAAATACCTACAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

FI14123.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:37:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG33474-RA 606 CG33474-RA 1..606 13..618 3030 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:47:59
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 6309681..6310449 1..769 3815 99.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:24:38 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:47:57
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10422221..10422990 1..770 3850 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:54:11
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 10423420..10424189 1..770 3850 100 Plus
Blast to na_te.dros performed on 2019-03-16 10:47:57 has no hits.

FI14123.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:48:43 Download gff for FI14123.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 6309681..6310449 1..769 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-03-24 15:21:42 Download gff for FI14123.complete
Subject Subject Range Query Range Percent Splice Strand
CG33474-RA 1..606 13..618 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:57:33 Download gff for FI14123.complete
Subject Subject Range Query Range Percent Splice Strand
CG33474-RA 1..606 13..618 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:00:15 Download gff for FI14123.complete
Subject Subject Range Query Range Percent Splice Strand
CG33474-RA 1..606 13..618 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:17:07 Download gff for FI14123.complete
Subject Subject Range Query Range Percent Splice Strand
CG33474-RA 1..606 13..618 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-03-24 15:21:42 Download gff for FI14123.complete
Subject Subject Range Query Range Percent Splice Strand
CG33474-RA 1..606 13..618 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:57:33 Download gff for FI14123.complete
Subject Subject Range Query Range Percent Splice Strand
CG33474-RA 1..606 13..618 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:00:15 Download gff for FI14123.complete
Subject Subject Range Query Range Percent Splice Strand
CG33474-RA 516..1284 1..769 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:17:07 Download gff for FI14123.complete
Subject Subject Range Query Range Percent Splice Strand
CG33474-RA 516..1284 1..769 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:48:43 Download gff for FI14123.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10422221..10422989 1..769 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:48:43 Download gff for FI14123.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10422221..10422989 1..769 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:48:43 Download gff for FI14123.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10422221..10422989 1..769 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:00:15 Download gff for FI14123.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6309726..6310494 1..769 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:34:20 Download gff for FI14123.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10423420..10424188 1..769 100   Plus

FI14123.pep Sequence

Translation from 12 to 617

> FI14123.pep
MAKFINEIGELLDSCRAREVLMEVLCQSAQLVIGYQINQSPDLNNVGSED
SGEPPVLRYTVDSELHDYEPDRITALLTVMSNTVDLLFYPVDTICWLASH
KVFDVKKQKTWRFVNSLLSMVSAYLNVVRISRIFLQDGYKLSHFDVVSLA
HFLFDLLHNICSLPRSYLWGMKHSSLYLGVIGTVSAGLGICQILTKRRLT
K*

FI14123.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 21:27:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12123-PA 217 GF12123-PA 5..214 2..198 474 44.8 Plus
Dana\GF16987-PA 233 GF16987-PA 6..233 3..201 434 39.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:27:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24164-PA 210 GG24164-PA 1..198 1..201 722 71.2 Plus
Dere\GG11196-PA 233 GG11196-PA 6..233 3..201 432 39.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 21:27:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18517-PA 236 GH18517-PA 6..236 3..201 389 37.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:19:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG33474-PB 201 CG33474-PB 1..201 1..201 1040 100 Plus
CG33474-PA 201 CG33474-PA 1..201 1..201 1040 100 Plus
CG13827-PA 233 CG13827-PA 6..233 3..201 415 39 Plus
CG13827-PB 234 CG13827-PB 20..234 16..201 377 38.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 21:27:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24362-PA 236 GI24362-PA 6..236 3..201 414 39 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 21:27:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24492-PA 233 GL24492-PA 5..233 2..201 427 39.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 21:27:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12553-PA 233 GA12553-PA 5..233 2..201 429 39.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:27:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21215-PA 201 GM21215-PA 1..201 1..201 980 90.5 Plus
Dsec\GM26496-PA 233 GM26496-PA 6..233 3..201 432 39.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:27:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25984-PA 201 GD25984-PA 1..201 1..201 964 88.6 Plus
Dsim\GD21009-PA 233 GD21009-PA 6..233 3..201 434 39.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 21:27:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24372-PA 236 GJ24372-PA 6..236 3..201 407 39 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 21:27:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11520-PA 233 GK11520-PA 5..233 2..201 411 39.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:27:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10363-PA 233 GE10363-PA 6..233 3..201 430 39.5 Plus
Dyak\GE19358-PA 80 GE19358-PA 2..80 124..201 202 57 Plus

FI14123.hyp Sequence

Translation from 12 to 617

> FI14123.hyp
MAKFINEIGELLDSCRAREVLMEVLCQSAQLVIGYQINQSPDLNNVGSED
SGEPPVLRYTVDSELHDYEPDRITALLTVMSNTVDLLFYPVDTICWLASH
KVFDVKKQKTWRFVNSLLSMVSAYLNVVRISRIFLQDGYKLSHFDVVSLA
HFLFDLLHNICSLPRSYLWGMKHSSLYLGVIGTVSAGLGICQILTKRRLT
K*

FI14123.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:19:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG33474-PB 201 CG33474-PB 1..201 1..201 1040 100 Plus
CG33474-PA 201 CG33474-PA 1..201 1..201 1040 100 Plus
CG13827-PA 233 CG13827-PA 6..233 3..201 415 39 Plus
CG13827-PB 234 CG13827-PB 20..234 16..201 377 38.6 Plus