BDGP Sequence Production Resources |
Search the DGRC for FI14123
Library: | FI |
Tissue Source: | various Drosophila melanogaster |
Created by: | |
Date Registered: | 2005-11-08 |
Comments: | Drosophila melanogaster corrected cDNA clones |
Original Plate Number: | 141 |
Well: | 23 |
Vector: | pOT2 |
Associated Gene/Transcript | CG33474-RA |
Protein status: | FI14123.pep: gold |
Sequenced Size: | 800 |
800 bp assembled on 2010-03-24
GenBank Submission: BT122120.1
> FI14123.complete TAGCATACAATTATGGCAAAGTTTATAAATGAGATCGGTGAACTTCTTGA TTCCTGTAGAGCCCGAGAGGTTTTGATGGAGGTATTATGCCAAAGTGCCC AATTGGTAATAGGATACCAAATCAATCAGAGTCCAGACCTAAACAATGTG GGTTCAGAAGACTCTGGGGAGCCACCTGTGCTTCGGTACACTGTGGACAG CGAACTGCACGACTATGAACCAGATCGCATTACGGCTCTATTGACGGTGA TGTCAAATACGGTGGATCTGCTTTTCTATCCCGTAGACACCATTTGCTGG CTGGCCAGTCACAAAGTTTTCGATGTCAAAAAACAGAAGACCTGGCGCTT TGTGAACTCGTTACTCAGCATGGTCTCTGCATACCTAAACGTCGTGAGAA TTTCAAGAATTTTCTTACAAGATGGCTATAAACTAAGTCACTTCGATGTT GTGTCCCTTGCACACTTTTTATTCGATCTGCTTCACAACATCTGCAGTTT ACCAAGGAGTTACCTGTGGGGCATGAAGCATTCATCCCTTTACTTGGGAG TTATTGGCACCGTTTCTGCTGGACTGGGAATTTGCCAGATTTTGACCAAA AGAAGGCTGACCAAGTAGAAGGTTTTGCCATTGATGCTGATTTTGGTGAA TGAAATTTGAAGATAGTCGTTATCGTATTTTTGGCGTGGTGATATTGATA AGACATTTGAATGAGCCTCTAGTTGGCATTCGTTTTATAAGTACAATAAA AATAGTTTGAAATACCTACAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG33474-RA | 606 | CG33474-RA | 1..606 | 13..618 | 3030 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 6309681..6310449 | 1..769 | 3815 | 99.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 10422221..10422990 | 1..770 | 3850 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 10423420..10424189 | 1..770 | 3850 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 6309681..6310449 | 1..769 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33474-RA | 1..606 | 13..618 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33474-RA | 1..606 | 13..618 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33474-RA | 1..606 | 13..618 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33474-RA | 1..606 | 13..618 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33474-RA | 1..606 | 13..618 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33474-RA | 1..606 | 13..618 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33474-RA | 516..1284 | 1..769 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33474-RA | 516..1284 | 1..769 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 10422221..10422989 | 1..769 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 10422221..10422989 | 1..769 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 10422221..10422989 | 1..769 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 6309726..6310494 | 1..769 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 10423420..10424188 | 1..769 | 100 | Plus |
Translation from 12 to 617
> FI14123.pep MAKFINEIGELLDSCRAREVLMEVLCQSAQLVIGYQINQSPDLNNVGSED SGEPPVLRYTVDSELHDYEPDRITALLTVMSNTVDLLFYPVDTICWLASH KVFDVKKQKTWRFVNSLLSMVSAYLNVVRISRIFLQDGYKLSHFDVVSLA HFLFDLLHNICSLPRSYLWGMKHSSLYLGVIGTVSAGLGICQILTKRRLT K*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF12123-PA | 217 | GF12123-PA | 5..214 | 2..198 | 474 | 44.8 | Plus |
Dana\GF16987-PA | 233 | GF16987-PA | 6..233 | 3..201 | 434 | 39.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG24164-PA | 210 | GG24164-PA | 1..198 | 1..201 | 722 | 71.2 | Plus |
Dere\GG11196-PA | 233 | GG11196-PA | 6..233 | 3..201 | 432 | 39.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH18517-PA | 236 | GH18517-PA | 6..236 | 3..201 | 389 | 37.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG33474-PB | 201 | CG33474-PB | 1..201 | 1..201 | 1040 | 100 | Plus |
CG33474-PA | 201 | CG33474-PA | 1..201 | 1..201 | 1040 | 100 | Plus |
CG13827-PA | 233 | CG13827-PA | 6..233 | 3..201 | 415 | 39 | Plus |
CG13827-PB | 234 | CG13827-PB | 20..234 | 16..201 | 377 | 38.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI24362-PA | 236 | GI24362-PA | 6..236 | 3..201 | 414 | 39 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL24492-PA | 233 | GL24492-PA | 5..233 | 2..201 | 427 | 39.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12553-PA | 233 | GA12553-PA | 5..233 | 2..201 | 429 | 39.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21215-PA | 201 | GM21215-PA | 1..201 | 1..201 | 980 | 90.5 | Plus |
Dsec\GM26496-PA | 233 | GM26496-PA | 6..233 | 3..201 | 432 | 39.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD25984-PA | 201 | GD25984-PA | 1..201 | 1..201 | 964 | 88.6 | Plus |
Dsim\GD21009-PA | 233 | GD21009-PA | 6..233 | 3..201 | 434 | 39.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ24372-PA | 236 | GJ24372-PA | 6..236 | 3..201 | 407 | 39 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK11520-PA | 233 | GK11520-PA | 5..233 | 2..201 | 411 | 39.7 | Plus |
Translation from 12 to 617
> FI14123.hyp MAKFINEIGELLDSCRAREVLMEVLCQSAQLVIGYQINQSPDLNNVGSED SGEPPVLRYTVDSELHDYEPDRITALLTVMSNTVDLLFYPVDTICWLASH KVFDVKKQKTWRFVNSLLSMVSAYLNVVRISRIFLQDGYKLSHFDVVSLA HFLFDLLHNICSLPRSYLWGMKHSSLYLGVIGTVSAGLGICQILTKRRLT K*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG33474-PB | 201 | CG33474-PB | 1..201 | 1..201 | 1040 | 100 | Plus |
CG33474-PA | 201 | CG33474-PA | 1..201 | 1..201 | 1040 | 100 | Plus |
CG13827-PA | 233 | CG13827-PA | 6..233 | 3..201 | 415 | 39 | Plus |
CG13827-PB | 234 | CG13827-PB | 20..234 | 16..201 | 377 | 38.6 | Plus |