Clone FI14129 Report

Search the DGRC for FI14129

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:141
Well:29
Vector:pOT2
Associated Gene/TranscriptCG4269-RA
Protein status:FI14129.pep: gold
Sequenced Size:540

Clone Sequence Records

FI14129.complete Sequence

540 bp assembled on 2010-03-24

GenBank Submission: BT122114.1

> FI14129.complete
TCCGAAGGAAATATCACCTCGTCCGGGTACTTAGCGAATAGCGAATTGAC
CGTGGAGTGGATAAAGTGTTAGTGGAGCAACAGAATGGCTAAGAATATGT
TCAGCAATATATTGGTGGTGACACTACTCGTACTCAGTTCGGATGTCGAA
GCACGACCCTCCTCCTCGGGTGTTGGTGGTGAGGCGAACGTGGATCCCAG
CGAATACCACGGCAATCTGTCGGTGGAAACGGTGCTAAAAGTGCAGCAGT
GCGAGAAGGACACCAACACGATGGAGCTGTGCATGCGGTGCGCCAAGGTG
ACCAAGTCGGAATTCGTCTATCCCATGTGCTGCGGCAACGAAGATGGCAT
CAAGGACTGGTGCCGGGAGTATGTGTACTTCGGCAACGAGTAGAGCCGGA
ATGGGGGTCAGGAGGCGATGGATGCTGTGTAAATTGGTTCGCGCTCCTGC
ATGGATTGGCTGTGATAAACCCACTGTATTTATTTAAATTATATTTAGGA
ATAAACAAGGCTAAATTAGCGTAAAAAAAAAAAAAAAAAA

FI14129.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:37:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG4269-RA 734 CG4269-RA 157..679 1..523 2615 100 Plus
CG4269.a 960 CG4269.a 157..679 1..523 2615 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:20:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 18486401..18486826 97..522 2100 99.5 Plus
chr2R 21145070 chr2R 18485845..18485940 1..96 480 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:24:40 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:20:11
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 22599911..22600337 97..523 2135 100 Plus
2R 25286936 2R 22599355..22599450 1..96 480 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:54:06
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 22601110..22601536 97..523 2135 100 Plus
2R 25260384 2R 22600554..22600649 1..96 480 100 Plus
Blast to na_te.dros performed on 2019-03-16 15:20:12 has no hits.

FI14129.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:21:10 Download gff for FI14129.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 18485845..18485940 1..96 100 -> Plus
chr2R 18486401..18486826 97..522 94   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-03-24 14:38:51 Download gff for FI14129.complete
Subject Subject Range Query Range Percent Splice Strand
CG4269-RA 1..309 85..393 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:57:25 Download gff for FI14129.complete
Subject Subject Range Query Range Percent Splice Strand
CG4269-RA 1..309 85..393 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:43:17 Download gff for FI14129.complete
Subject Subject Range Query Range Percent Splice Strand
CG4269-RA 1..309 85..393 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:44:35 Download gff for FI14129.complete
Subject Subject Range Query Range Percent Splice Strand
CG4269-RA 1..309 85..393 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-03-24 14:38:51 Download gff for FI14129.complete
Subject Subject Range Query Range Percent Splice Strand
CG4269-RA 1..522 1..522 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:57:25 Download gff for FI14129.complete
Subject Subject Range Query Range Percent Splice Strand
CG4269-RA 1..522 1..522 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:43:17 Download gff for FI14129.complete
Subject Subject Range Query Range Percent Splice Strand
CG4269-RA 18..539 1..522 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:44:35 Download gff for FI14129.complete
Subject Subject Range Query Range Percent Splice Strand
CG4269-RA 18..539 1..522 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:21:10 Download gff for FI14129.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22599355..22599450 1..96 100 -> Plus
2R 22599911..22600336 97..522 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:21:10 Download gff for FI14129.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22599355..22599450 1..96 100 -> Plus
2R 22599911..22600336 97..522 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:21:10 Download gff for FI14129.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22599355..22599450 1..96 100 -> Plus
2R 22599911..22600336 97..522 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:43:17 Download gff for FI14129.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18486860..18486955 1..96 100 -> Plus
arm_2R 18487416..18487841 97..522 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:34:11 Download gff for FI14129.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22601110..22601535 97..522 100   Plus
2R 22600554..22600649 1..96 100 -> Plus

FI14129.pep Sequence

Translation from 84 to 392

> FI14129.pep
MAKNMFSNILVVTLLVLSSDVEARPSSSGVGGEANVDPSEYHGNLSVETV
LKVQQCEKDTNTMELCMRCAKVTKSEFVYPMCCGNEDGIKDWCREYVYFG
NE*

FI14129.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 21:27:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11901-PA 99 GF11901-PA 1..99 1..102 365 67.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:27:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21055-PA 96 GG21055-PA 1..96 1..102 461 88.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 21:27:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20473-PA 81 GH20473-PA 2..78 26..102 288 63.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:41:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG4269-PC 102 CG4269-PC 1..102 1..102 545 100 Plus
CG4269-PA 102 CG4269-PA 1..102 1..102 545 100 Plus
CG4269-PB 98 CG4269-PB 1..98 5..102 525 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 21:27:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21015-PA 121 GI21015-PA 39..118 22..102 287 63 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 21:27:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11588-PA 119 GL11588-PA 35..116 21..102 324 70.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 21:27:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18071-PA 109 GA18071-PA 1..106 1..102 328 62.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:27:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15923-PA 100 GM15923-PA 1..100 1..102 509 95.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:27:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11678-PA 239 GD11678-PA 141..239 5..102 509 96 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 21:27:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21937-PA 124 GJ21937-PA 31..121 17..102 311 63.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 21:27:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22162-PA 100 GK22162-PA 4..95 3..100 335 63.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:27:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13997-PA 96 GE13997-PA 1..96 1..102 456 86.3 Plus

FI14129.hyp Sequence

Translation from 84 to 392

> FI14129.hyp
MAKNMFSNILVVTLLVLSSDVEARPSSSGVGGEANVDPSEYHGNLSVETV
LKVQQCEKDTNTMELCMRCAKVTKSEFVYPMCCGNEDGIKDWCREYVYFG
NE*

FI14129.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:03:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG4269-PC 102 CG4269-PC 1..102 1..102 545 100 Plus
CG4269-PA 102 CG4269-PA 1..102 1..102 545 100 Plus
CG4269-PB 98 CG4269-PB 1..98 5..102 525 100 Plus