Clone FI14216 Report

Search the DGRC for FI14216

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:142
Well:16
Vector:pOT2
Associated Gene/TranscriptE(spl)m4-BFM-RA
Protein status:FI14216.pep: gold
Sequenced Size:867

Clone Sequence Records

FI14216.complete Sequence

867 bp assembled on 2010-04-28

GenBank Submission: BT124871.1

> FI14216.complete
TACAGTACACATCTCAGCTACACAGCAGCTAAACACAAAATTCCAAAACA
CATCATCATGTGCCAGAACAAGATCAACACCAACAACACCATGACCATCA
AATCGAACAAGAAGCTGTCCTACAGCGTGAAGAAACTGCTGCAGAAGATC
TTCAAGCAGCAACAGCGCGTCGAGGAGGAGCAGAACCTCAAGAACGCCCT
CAAGGCCAACTCTTTGGAGTCTCTGGAATCCATGGAAAACAGCCGCAACG
CCGATCTGGAATCCGCCTCCATCTGCGCCTCTCTGGAGTCCTGCGAGAAC
GAGGCCAACGAGCGTCTCTCCCAGTCCTGCGAAATTGAGGACTACGACTT
CGAGCAACTGCCCACCGTTCCCGTTCACTTCGTCCGCACCGCTCACGGCA
CATTCTTCTGGACCGCCGTCTCCGATTTGCCAGCCGACAACGACCTCGTC
GAGCCCCTCTACTGCAGCACCTCCAACGCCATCGCTATCCCCCAGGATCG
TTGGGTTCAGGCCTAAAAAATATCAGCGTCCTGCAACCTGCATCCATCAT
CCGGCAACTATGTCTTCCATTGGATCTCCAGCTTTAATCAACGTCTTCCG
TTAATTTTTGAAACCATTCCACAAAAATTAACACGCAAGCCGATCAACTC
AACTGAAGAGCTTTACAAAAATTGTGATACATTTTACTTAACAAACACAA
AAAAATCAAAATATATATACAATTTAAATGAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAA

FI14216.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:16:54
Subject Length Description Subject Range Query Range Score Percent Strand
m4-RA 459 m4-RA 1..459 58..516 2295 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:49:31
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 21846811..21847540 730..1 3650 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:49:29
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 26023818..26024550 733..1 3665 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:34:28
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 25764649..25765381 733..1 3665 100 Minus
Blast to na_te.dros performed 2019-03-16 02:49:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6714..6840 46..182 139 61.6 Plus
mdg1 7480 mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). 6840..6920 645..725 137 67.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2307..2430 69..195 132 62.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2453..2533 14..91 117 65.4 Plus

FI14216.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:50:27 Download gff for FI14216.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 21846811..21847540 1..730 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-04-28 15:06:14 Download gff for FI14216.complete
Subject Subject Range Query Range Percent Splice Strand
m4-RA 1..459 58..516 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:25:06 Download gff for FI14216.complete
Subject Subject Range Query Range Percent Splice Strand
m4-RA 1..459 58..516 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:46:38 Download gff for FI14216.complete
Subject Subject Range Query Range Percent Splice Strand
E(spl)m4-BFM-RA 1..459 58..516 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:22:24 Download gff for FI14216.complete
Subject Subject Range Query Range Percent Splice Strand
E(spl)m4-BFM-RA 1..459 58..516 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-04-28 15:06:14 Download gff for FI14216.complete
Subject Subject Range Query Range Percent Splice Strand
m4-RA 1..459 58..516 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:25:06 Download gff for FI14216.complete
Subject Subject Range Query Range Percent Splice Strand
m4-RA 9..733 1..725 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:46:38 Download gff for FI14216.complete
Subject Subject Range Query Range Percent Splice Strand
E(spl)m4-BFM-RA 30..759 1..730 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:22:24 Download gff for FI14216.complete
Subject Subject Range Query Range Percent Splice Strand
E(spl)m4-BFM-RA 30..759 1..730 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:50:27 Download gff for FI14216.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26023821..26024550 1..730 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:50:27 Download gff for FI14216.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26023821..26024550 1..730 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:50:27 Download gff for FI14216.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26023821..26024550 1..730 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:46:38 Download gff for FI14216.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21849543..21850272 1..730 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:57:13 Download gff for FI14216.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25764652..25765381 1..730 100   Minus

FI14216.pep Sequence

Translation from 0 to 515

> FI14216.pep
YSTHLSYTAAKHKIPKHIIMCQNKINTNNTMTIKSNKKLSYSVKKLLQKI
FKQQQRVEEEQNLKNALKANSLESLESMENSRNADLESASICASLESCEN
EANERLSQSCEIEDYDFEQLPTVPVHFVRTAHGTFFWTAVSDLPADNDLV
EPLYCSTSNAIAIPQDRWVQA*

FI14216.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:47:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18223-PA 151 GF18223-PA 1..151 20..171 660 83.9 Plus
Dana\GF16797-PA 134 GF16797-PA 1..134 20..171 175 40.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:47:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12205-PA 152 GG12205-PA 1..152 20..171 800 99.3 Plus
Dere\GG11451-PA 143 GG11451-PA 1..143 20..171 171 37.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:47:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18146-PA 156 GH18146-PA 1..156 20..171 578 75.9 Plus
Dgri\GH19453-PA 146 GH19453-PA 16..146 38..171 194 42 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:31:04
Subject Length Description Subject Range Query Range Score Percent Strand
E(spl)m4-BFM-PA 152 CG6099-PA 1..152 20..171 784 100 Plus
E(spl)malpha-BFM-PA 138 CG8337-PA 1..138 20..171 217 39.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:47:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22908-PA 156 GI22908-PA 1..156 20..171 592 79.1 Plus
Dmoj\GI24687-PA 132 GI24687-PA 2..132 38..171 202 42.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:47:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22019-PA 156 GL22019-PA 1..156 20..171 631 80.8 Plus
Dper\GL21817-PA 143 GL21817-PA 1..143 20..171 181 40.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:47:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19352-PA 156 GA19352-PA 1..156 20..171 631 80.8 Plus
Dpse\GA21000-PA 143 GA21000-PA 1..143 20..171 181 40.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:47:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10204-PA 152 GM10204-PA 1..152 20..171 805 100 Plus
Dsec\GM10295-PA 140 GM10295-PA 1..140 20..171 172 37.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:47:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\m4-PA 151 GD18154-PA 1..151 20..171 782 98.7 Plus
Dsim\malpha-PA 140 GD21259-PA 1..140 20..171 172 37.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:47:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23320-PA 156 GJ23320-PA 1..156 20..171 534 75.9 Plus
Dvir\malpha-PA 148 GJ23904-PA 1..148 20..171 208 39.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:47:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12805-PA 150 GK12805-PA 16..150 33..171 588 81.3 Plus
Dwil\GK14456-PA 142 GK14456-PA 1..142 20..171 180 42 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:47:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\m4-PA 152 GE10649-PA 1..152 20..171 796 98.7 Plus
Dyak\malpha-PA 144 GE23645-PA 1..144 20..171 159 38.2 Plus

FI14216.hyp Sequence

Translation from 214 to 729

> FI14216.hyp
YSTHLSYTAAKHKIPKHIIMCQNKINTNNTMTIKSNKKLSYSVKKLLQKI
FKQQQRVEEEQNLKNALKANSLESLESMENSRNADLESASICASLESCEN
EANERLSQSCEIEDYDFEQLPTVPVHFVRTAHGTFFWTAVSDLPADNDLV
EPLYCSTSNAIAIPQDRWVQA*

FI14216.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:51:17
Subject Length Description Subject Range Query Range Score Percent Strand
E(spl)m4-BFM-PA 152 CG6099-PA 1..152 20..171 784 100 Plus
E(spl)malpha-BFM-PA 138 CG8337-PA 1..138 20..171 217 39.8 Plus