Clone FI14313 Report

Search the DGRC for FI14313

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:143
Well:13
Vector:pOT2
Associated Gene/TranscriptCG9396-RA
Protein status:FI14313.pep: gold
Sequenced Size:701

Clone Sequence Records

FI14313.complete Sequence

701 bp assembled on 2010-03-24

GenBank Submission: BT122119.1

> FI14313.complete
GACGCCTGGTTGGAGCTGTTGTGCCTCAGTTTGTTCAGGAGCACTACTTC
CCAACTGGTTTATCGCAGTCCCAGGCGATTGTTATTCCAGCGCTTCCAAT
CAATCAGCCCATACTCAACAAATACTTGATTACAGGAAAAACAGTAGCGT
TCCGGAATGTCTGCCACTCCTCCAACAACACCTGCGCCCACGGCTGCAGC
TTCCGCCGGAAAGGGTCTTCACTCCAGGGCATATAATGGACTTATCAAGG
CCTGCGACAAGTATGTGCCCCCCAAGATGCGACCCTTGTGGATGCACCCA
GCAGGACCCAAGACCATATTCTTTTGGGCTCCAATCGTTAAGTGGAGCCT
CGTTATCGCGGGTCTCAGTGATTTGACGCGTCCTGCGGACAAGATTTCGC
CTAACGGATGTCTGGCTCTTGGGGCAACGAACCTCATCTGGACGCGCTAC
TCTCTGGTGATCATTCCCAAGAACTACAGCTTGTTCGCGGTTAATCTCTT
CGTGAGTCTGACGCAGCTCTTCCAATTGGGTAGGTACTACAACTACCAGT
GGGAGCAGTCGAGGCTGGAGAAAAATGGCGAGCAATGCCCGGCTATTGAA
GCCAGTTTGTAGTAGTCCAATTTGTGCATTTCAATGGATTTAGTCTAAAT
AAAAACAAGTTTTAAGGCTTTAACGGTCAATAAAAAAAAAAAAAAAAAAA
A

FI14313.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:37:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG9396-RA 1077 CG9396-RA 153..834 1..682 3410 100 Plus
CG9396.a 1003 CG9396.a 79..760 1..682 3410 100 Plus
CG9399.d 1092 CG9399.d 337..407 434..504 250 90.1 Plus
CG9399.d 1092 CG9399.d 158..294 255..391 235 78.1 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:57:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 5396261..5396597 681..345 1670 99.7 Minus
chr3R 27901430 chr3R 5397078..5397249 305..134 860 100 Minus
chr3R 27901430 chr3R 5397335..5397470 136..1 665 99.3 Minus
chr3R 27901430 chr3R 5398443..5398513 504..434 250 90.1 Minus
chr3R 27901430 chr3R 5396980..5397023 345..302 220 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:24:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:57:45
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9570413..9570750 682..345 1690 100 Minus
3R 32079331 3R 9571231..9571402 305..134 860 100 Minus
3R 32079331 3R 9571488..9571623 136..1 680 100 Minus
3R 32079331 3R 9572596..9572666 504..434 250 90.1 Minus
3R 32079331 3R 9571133..9571176 345..302 220 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:54:10
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 9311244..9311581 682..345 1690 100 Minus
3R 31820162 3R 9312062..9312233 305..134 860 100 Minus
3R 31820162 3R 9312319..9312454 136..1 680 100 Minus
3R 31820162 3R 9313427..9313497 504..434 250 90.1 Minus
3R 31820162 3R 9311964..9312007 345..302 220 100 Minus
Blast to na_te.dros performed on 2019-03-16 08:57:45 has no hits.

FI14313.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:58:31 Download gff for FI14313.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 5397079..5397247 136..304 100 <- Minus
chr3R 5397336..5397470 1..135 99   Minus
chr3R 5396261..5396596 346..681 99 <- Minus
chr3R 5396980..5397020 305..345 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-03-24 15:11:00 Download gff for FI14313.complete
Subject Subject Range Query Range Percent Splice Strand
CG9396-RA 1..456 157..612 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:57:32 Download gff for FI14313.complete
Subject Subject Range Query Range Percent Splice Strand
CG9396-RA 1..456 157..612 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:35:09 Download gff for FI14313.complete
Subject Subject Range Query Range Percent Splice Strand
CG9396-RA 1..456 157..612 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:55:08 Download gff for FI14313.complete
Subject Subject Range Query Range Percent Splice Strand
CG9396-RA 1..456 157..612 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-03-24 15:10:59 Download gff for FI14313.complete
Subject Subject Range Query Range Percent Splice Strand
CG9396-RA 1..681 1..681 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:57:32 Download gff for FI14313.complete
Subject Subject Range Query Range Percent Splice Strand
CG9396-RA 1..681 1..681 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:35:09 Download gff for FI14313.complete
Subject Subject Range Query Range Percent Splice Strand
CG9396-RA 1..681 1..681 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:55:08 Download gff for FI14313.complete
Subject Subject Range Query Range Percent Splice Strand
CG9396-RA 1..681 1..681 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:58:31 Download gff for FI14313.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9570414..9570749 346..681 100 <- Minus
3R 9571133..9571173 305..345 100 <- Minus
3R 9571232..9571400 136..304 100 <- Minus
3R 9571489..9571623 1..135 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:58:31 Download gff for FI14313.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9570414..9570749 346..681 100 <- Minus
3R 9571133..9571173 305..345 100 <- Minus
3R 9571232..9571400 136..304 100 <- Minus
3R 9571489..9571623 1..135 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:58:31 Download gff for FI14313.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9570414..9570749 346..681 100 <- Minus
3R 9571133..9571173 305..345 100 <- Minus
3R 9571232..9571400 136..304 100 <- Minus
3R 9571489..9571623 1..135 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:35:09 Download gff for FI14313.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5396954..5397122 136..304 100 <- Minus
arm_3R 5397211..5397345 1..135 100   Minus
arm_3R 5396136..5396471 346..681 100 <- Minus
arm_3R 5396855..5396895 305..345 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:34:19 Download gff for FI14313.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9311245..9311580 346..681 100 <- Minus
3R 9311964..9312004 305..345 100 <- Minus
3R 9312063..9312231 136..304 100 <- Minus
3R 9312320..9312454 1..135 100   Minus

FI14313.pep Sequence

Translation from 156 to 611

> FI14313.pep
MSATPPTTPAPTAAASAGKGLHSRAYNGLIKACDKYVPPKMRPLWMHPAG
PKTIFFWAPIVKWSLVIAGLSDLTRPADKISPNGCLALGATNLIWTRYSL
VIIPKNYSLFAVNLFVSLTQLFQLGRYYNYQWEQSRLEKNGEQCPAIEAS
L*

FI14313.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 21:27:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16533-PA 150 GF16533-PA 2..149 3..151 665 85.9 Plus
Dana\GF16532-PA 156 GF16532-PA 26..148 18..140 506 73.2 Plus
Dana\GF14537-PA 140 GF14537-PA 2..123 16..136 319 50 Plus
Dana\GF15117-PA 143 GF15117-PA 6..122 24..139 267 44.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:27:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17358-PA 152 GG17358-PA 18..152 18..151 675 94.1 Plus
Dere\GG17356-PA 154 GG17356-PA 18..148 12..142 503 68.7 Plus
Dere\GG21765-PA 140 GG21765-PA 2..123 16..136 328 54.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 21:27:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19299-PA 156 GH19299-PA 25..154 18..147 490 73.1 Plus
Dgri\GH13770-PA 140 GH13770-PA 2..123 16..136 313 50.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:00:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG9396-PA 151 CG9396-PA 1..151 1..151 809 100 Plus
CG9399-PD 154 CG9399-PD 11..153 5..148 518 66.7 Plus
CG9399-PA 154 CG9399-PA 11..153 5..148 518 66.7 Plus
CG9399-PB 154 CG9399-PB 11..153 5..148 518 66.7 Plus
CG9399-PE 120 CG9399-PE 1..119 29..148 439 68.3 Plus
CG32832-PB 140 CG32832-PB 2..123 16..136 326 53.3 Plus
CG32832-PA 140 CG32832-PA 2..123 16..136 326 53.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 21:27:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23515-PA 154 GI23515-PA 23..152 18..147 533 72.3 Plus
Dmoj\GI17910-PA 140 GI17910-PA 2..123 16..136 329 54.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 21:27:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21495-PA 149 GL21495-PA 2..146 5..147 626 81.4 Plus
Dper\GL21494-PA 155 GL21494-PA 24..153 18..147 522 72.3 Plus
Dper\GL19324-PA 140 GL19324-PA 2..123 16..136 335 55.7 Plus
Dper\GL16074-PA 141 GL16074-PA 3..109 21..126 208 42.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 21:27:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26298-PA 149 GA26298-PA 2..146 5..147 626 81.4 Plus
Dpse\GA26297-PA 155 GA26297-PA 24..153 18..147 522 72.3 Plus
Dpse\GA25919-PA 140 GA25919-PA 2..123 16..136 335 55.7 Plus
Dpse\GA26115-PA 141 GA26115-PA 3..109 21..126 208 42.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:27:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26243-PA 151 GM26243-PA 1..151 1..151 767 96 Plus
Dsec\GM26242-PA 154 GM26242-PA 24..137 18..131 471 73.7 Plus
Dsec\GM17149-PA 140 GM17149-PA 2..123 16..136 319 52.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:27:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20783-PA 151 GD20783-PA 1..151 1..151 784 98 Plus
Dsim\GD20782-PA 154 GD20782-PA 24..153 18..148 498 68.7 Plus
Dsim\GD21889-PA 140 GD21889-PA 2..123 16..136 319 52.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 21:27:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10267-PA 157 GJ10267-PA 26..155 18..147 538 75.4 Plus
Dvir\GJ17418-PA 141 GJ17418-PA 2..123 16..136 324 53.3 Plus
Dvir\GJ17419-PA 126 GJ17419-PA 2..123 16..136 319 51.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 21:27:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11251-PA 141 GK11251-PA 5..135 13..143 538 74.8 Plus
Dwil\GK11250-PA 154 GK11250-PA 21..153 18..148 514 70.7 Plus
Dwil\GK18148-PA 91 GK18148-PA 2..87 16..100 245 54.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:27:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24762-PA 152 GE24762-PA 18..152 18..151 664 91.9 Plus
Dyak\GE24761-PA 152 GE24761-PA 24..146 18..140 486 69.9 Plus
Dyak\GE13155-PA 140 GE13155-PA 2..123 16..136 321 51.6 Plus

FI14313.hyp Sequence

Translation from 156 to 611

> FI14313.hyp
MSATPPTTPAPTAAASAGKGLHSRAYNGLIKACDKYVPPKMRPLWMHPAG
PKTIFFWAPIVKWSLVIAGLSDLTRPADKISPNGCLALGATNLIWTRYSL
VIIPKNYSLFAVNLFVSLTQLFQLGRYYNYQWEQSRLEKNGEQCPAIEAS
L*

FI14313.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:56:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG9396-PA 151 CG9396-PA 1..151 1..151 809 100 Plus
CG9399-PD 154 CG9399-PD 11..153 5..148 518 66.7 Plus
CG9399-PA 154 CG9399-PA 11..153 5..148 518 66.7 Plus
CG9399-PB 154 CG9399-PB 11..153 5..148 518 66.7 Plus
CG9399-PE 120 CG9399-PE 1..119 29..148 439 68.3 Plus