Clone FI14528 Report

Search the DGRC for FI14528

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:145
Well:28
Vector:pOT2
Associated Gene/TranscriptCG42713-RA
Protein status:FI14528.pep: gold
Sequenced Size:388

Clone Sequence Records

FI14528.complete Sequence

388 bp assembled on 2011-03-18

GenBank Submission: BT126170.1

> FI14528.complete
ATAGCATCAACATGAAATTCCTTCTGATCCTGGCCAGTGTGGTCCTCTAT
GTGGCCCTCAGCTCTGCTCAGTCTTGCCCAGGACGTCCATCCCATCAGAA
CTGCTTACACGGGAAGGACGAAGGAGTTGAACGCGCAAGGCATTGTAATA
GGGATCCCAATCCACAGATGTGGTACTACAACCAACGTGAAAATAGGTGC
ATCAAGATGAGGTACCTCGGCTGTAAGGGCAACCGCAATCGTTATTGCAC
ATTGAACGAGTGTCAAAGGAAATGCGTTCGACGATCATGAGGAGTGAATC
CATTTCAATTCCCCAAATGACGTGATGAATATAAAAAATAAAATATAATA
ACTTGCGCGAATCGAATGAAAAAAAAAAAAAAAAAAAA

FI14528.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:33:08
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 8890564..8890842 91..368 1330 99.3 Plus
chr2L 23010047 chr2L 8890407..8890496 1..90 435 98.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:33:07
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8891653..8891933 91..371 1405 100 Plus
2L 23513712 2L 8891496..8891585 1..90 450 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:08:43
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8891653..8891933 91..371 1405 100 Plus
2L 23513712 2L 8891496..8891585 1..90 450 100 Plus
Blast to na_te.dros performed on 2019-03-16 22:33:07 has no hits.

FI14528.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:33:57 Download gff for FI14528.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 8890407..8890496 1..90 98 -> Plus
chr2L 8890564..8890842 91..368 91   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-22 17:53:20 Download gff for FI14528.complete
Subject Subject Range Query Range Percent Splice Strand
CG42713-RA 1..279 12..290 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:57:41 Download gff for FI14528.complete
Subject Subject Range Query Range Percent Splice Strand
CG42713-RB 1..279 12..290 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:29:57 Download gff for FI14528.complete
Subject Subject Range Query Range Percent Splice Strand
CG42713-RB 1..279 12..290 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-22 17:53:20 Download gff for FI14528.complete
Subject Subject Range Query Range Percent Splice Strand
CG42713-RA 8..375 1..368 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:57:41 Download gff for FI14528.complete
Subject Subject Range Query Range Percent Splice Strand
CG42713-RB 57..424 1..368 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:29:57 Download gff for FI14528.complete
Subject Subject Range Query Range Percent Splice Strand
CG42713-RB 57..424 1..368 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:33:57 Download gff for FI14528.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8891653..8891930 91..368 100   Plus
2L 8891496..8891585 1..90 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:33:57 Download gff for FI14528.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8891653..8891930 91..368 100   Plus
2L 8891496..8891585 1..90 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:33:57 Download gff for FI14528.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8891653..8891930 91..368 100   Plus
2L 8891496..8891585 1..90 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:57:41 Download gff for FI14528.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8891496..8891585 1..90 100 -> Plus
arm_2L 8891653..8891930 91..368 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:01:33 Download gff for FI14528.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8891653..8891930 91..368 100   Plus
2L 8891496..8891585 1..90 100 -> Plus

FI14528.hyp Sequence

Translation from 2 to 289

> FI14528.hyp
SINMKFLLILASVVLYVALSSAQSCPGRPSHQNCLHGKDEGVERARHCNR
DPNPQMWYYNQRENRCIKMRYLGCKGNRNRYCTLNECQRKCVRRS*

FI14528.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:11:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG42713-PA 92 CG42713-PA 1..92 4..95 516 100 Plus
CG42713-PB 92 CG42713-PB 1..92 4..95 516 100 Plus
CG42537-PA 90 CG42537-PA 1..89 4..91 266 56.7 Plus
CG42538-PA 89 CG42538-PA 1..86 4..89 244 52.3 Plus
CG42717-PA 96 CG42717-PA 9..90 7..88 171 32.9 Plus

FI14528.pep Sequence

Translation from 2 to 289

> FI14528.pep
SINMKFLLILASVVLYVALSSAQSCPGRPSHQNCLHGKDEGVERARHCNR
DPNPQMWYYNQRENRCIKMRYLGCKGNRNRYCTLNECQRKCVRRS*

FI14528.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:25:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23759-PA 92 GF23759-PA 1..92 4..93 243 54.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:25:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25311-PA 92 GG25311-PA 1..92 4..95 408 81.5 Plus
Dere\GG13401-PA 555 GG13401-PA 496..554 32..91 173 51.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 18:25:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15461-PA 92 GH15461-PA 1..92 4..93 238 48.9 Plus
Dgri\GH15462-PA 141 GH15462-PA 1..82 4..83 208 48.8 Plus
Dgri\GH15464-PA 114 GH15464-PA 1..82 4..83 199 47.6 Plus
Dgri\GH23271-PA 116 GH23271-PA 1..82 4..83 199 47.6 Plus
Dgri\GH15463-PA 146 GH15463-PA 1..82 4..83 190 47.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:25:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG42713-PA 92 CG42713-PA 1..92 4..95 516 100 Plus
CG42713-PB 92 CG42713-PB 1..92 4..95 516 100 Plus
CG42537-PA 90 CG42537-PA 1..89 4..91 266 56.7 Plus
CG42538-PA 89 CG42538-PA 1..86 4..89 244 52.3 Plus
CG42717-PA 96 CG42717-PA 9..90 7..88 171 32.9 Plus
CG42716-PA 97 CG42716-PA 1..94 4..93 164 36.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 18:25:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16654-PA 96 GI16654-PA 1..84 4..83 204 53.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 18:25:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20811-PA 90 GL20811-PA 1..89 4..91 237 56.2 Plus
Dper\GL22203-PA 92 GL22203-PA 1..92 4..94 235 52.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 18:25:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28565-PA 90 GA28565-PA 1..89 4..91 243 57.3 Plus
Dpse\GA27412-PA 92 GA27412-PA 1..92 4..94 229 51.1 Plus
Dpse\GA28299-PA 95 GA28299-PA 22..95 20..93 146 37.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:25:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17228-PA 92 GM17228-PA 1..91 4..94 439 87.9 Plus
Dsec\GM25578-PA 89 GM25578-PA 1..86 4..89 232 52.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:25:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23572-PA 92 GD23572-PA 1..92 4..95 448 89.1 Plus
Dsim\GD14590-PA 89 GD14590-PA 1..86 4..89 224 51.2 Plus
Dsim\GD19871-PA 544 GD19871-PA 485..543 32..91 196 58.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 18:25:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12489-PA 96 GJ12489-PA 1..96 4..95 232 53.1 Plus
Dvir\GJ12906-PA 93 GJ12906-PA 1..90 4..91 205 46.7 Plus
Dvir\Kil-1-PA 113 GJ12487-PA 1..112 4..95 201 42 Plus
Dvir\Kil-2-PA 111 GJ12491-PA 1..94 4..93 177 41.5 Plus
Dvir\GJ12488-PA 105 GJ12488-PA 1..103 4..95 171 38.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 18:25:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23982-PA 91 GK23982-PA 1..91 4..93 205 48.4 Plus
Dwil\GK23993-PA 91 GK23993-PA 1..91 4..93 205 48.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:25:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18803-PA 92 GE18803-PA 1..91 4..94 347 82.4 Plus
Dyak\GE22885-PA 90 GE22885-PA 4..87 6..89 213 48.8 Plus
Dyak\GE19801-PA 90 GE19801-PA 4..87 6..89 213 48.8 Plus
Dyak\GE10217-PA 552 GE10217-PA 506..551 48..93 171 60.9 Plus