Clone FI14541 Report

Search the DGRC for FI14541

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:145
Well:41
Vector:pOT2
Associated Gene/TranscriptCG43103-RA
Protein status:FI14541.pep: gold
Sequenced Size:473

Clone Sequence Records

FI14541.complete Sequence

473 bp assembled on 2011-03-18

GenBank Submission: BT126232.1

> FI14541.complete
TAGTAGTCGAGTCACCTGGAGAAAACCGCGAAGATGCTATCAAGATCCGT
GCTGATCGTAGTAGGCCTACTAATGCTGAGCTGGCAGTGGACGATGGCCA
TGCCGCCCCTTCCGAAGAACCAACCCAGCGGAGTATCTATTAGTCAGCCC
GATATACCGGGAGCCTCGGATATTTTGGTGCAGAGCATCTTCAACATCGA
TCCATCGCTGTGTCCCAAGGGGTACATACGCACGGGTCCACATCACACGT
GTCGTAGGATAGCCTAGGAAGACAAGCTCTGAAGATCGATTTAAAGTTCA
ATATCAGAACGTGCTACAAGCTGTTTTTTTATTGATACTTAAATAAATTC
TATATAAATACTTGCAATTCTCACATACATATTTAAAAAATACGACACAT
TCGGTTTATATAAGTACAGGTTCATTAAAGTTAATCAACTGATTGTTGGC
ACTGATAAAAAAAAAAAAAAAAA

FI14541.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:33:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 13026655..13027110 456..1 2235 99.3 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:33:11
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17139446..17139905 460..1 2270 99.6 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:09:01
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 17140645..17141104 460..1 2270 99.5 Minus
Blast to na_te.dros performed 2019-03-16 22:33:12
Subject Length Description Subject Range Query Range Score Percent Strand
blood 7410 blood BLOOD 7410bp 6855..6936 315..391 128 65.9 Plus

FI14541.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:34:00 Download gff for FI14541.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 13026655..13027110 1..456 99   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-22 17:53:21 Download gff for FI14541.complete
Subject Subject Range Query Range Percent Splice Strand
CG43103-RA 1..234 34..267 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:57:45 Download gff for FI14541.complete
Subject Subject Range Query Range Percent Splice Strand
CG43103-RA 1..234 34..267 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:30:01 Download gff for FI14541.complete
Subject Subject Range Query Range Percent Splice Strand
CG43103-RA 1..234 34..267 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-22 17:53:20 Download gff for FI14541.complete
Subject Subject Range Query Range Percent Splice Strand
CG43103-RA 21..475 1..455 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:57:45 Download gff for FI14541.complete
Subject Subject Range Query Range Percent Splice Strand
CG43103-RA 21..476 1..456 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:30:01 Download gff for FI14541.complete
Subject Subject Range Query Range Percent Splice Strand
CG43103-RA 27..482 1..456 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:34:00 Download gff for FI14541.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17139450..17139905 1..456 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:34:00 Download gff for FI14541.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17139450..17139905 1..456 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:34:00 Download gff for FI14541.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17139450..17139905 1..456 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:57:45 Download gff for FI14541.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13026955..13027410 1..456 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:02:06 Download gff for FI14541.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17140649..17141104 1..456 99   Minus

FI14541.hyp Sequence

Translation from 33 to 266

> FI14541.hyp
MLSRSVLIVVGLLMLSWQWTMAMPPLPKNQPSGVSISQPDIPGASDILVQ
SIFNIDPSLCPKGYIRTGPHHTCRRIA*

FI14541.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:11:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG43103-PA 77 CG43103-PA 1..77 1..77 409 100 Plus

FI14541.pep Sequence

Translation from 33 to 266

> FI14541.pep
MLSRSVLIVVGLLMLSWQWTMAMPPLPKNQPSGVSISQPDIPGASDILVQ
SIFNIDPSLCPKGYIRTGPHHTCRRIA*

FI14541.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:25:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22211-PA 79 GG22211-PA 1..79 1..77 347 87.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:15:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG43103-PA 77 CG43103-PA 1..77 1..77 409 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 18:25:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17259-PA 73 GL17259-PA 1..73 1..77 133 38 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 18:25:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24153-PA 73 GA24153-PA 1..73 1..77 136 38 Plus
Dpse\GA22239-PA 73 GA22239-PA 1..73 1..77 133 38 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:25:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20000-PA 77 GM20000-PA 1..77 1..77 380 96.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:25:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25491-PA 77 GD25491-PA 1..77 1..77 391 98.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:25:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14208-PA 77 GE14208-PA 1..77 1..77 358 89.6 Plus