BDGP Sequence Production Resources |
Search the DGRC for FI14541
Library: | FI |
Tissue Source: | various Drosophila melanogaster |
Created by: | |
Date Registered: | 2005-11-08 |
Comments: | Drosophila melanogaster corrected cDNA clones |
Original Plate Number: | 145 |
Well: | 41 |
Vector: | pOT2 |
Associated Gene/Transcript | CG43103-RA |
Protein status: | FI14541.pep: gold |
Sequenced Size: | 473 |
473 bp assembled on 2011-03-18
GenBank Submission: BT126232.1
> FI14541.complete TAGTAGTCGAGTCACCTGGAGAAAACCGCGAAGATGCTATCAAGATCCGT GCTGATCGTAGTAGGCCTACTAATGCTGAGCTGGCAGTGGACGATGGCCA TGCCGCCCCTTCCGAAGAACCAACCCAGCGGAGTATCTATTAGTCAGCCC GATATACCGGGAGCCTCGGATATTTTGGTGCAGAGCATCTTCAACATCGA TCCATCGCTGTGTCCCAAGGGGTACATACGCACGGGTCCACATCACACGT GTCGTAGGATAGCCTAGGAAGACAAGCTCTGAAGATCGATTTAAAGTTCA ATATCAGAACGTGCTACAAGCTGTTTTTTTATTGATACTTAAATAAATTC TATATAAATACTTGCAATTCTCACATACATATTTAAAAAATACGACACAT TCGGTTTATATAAGTACAGGTTCATTAAAGTTAATCAACTGATTGTTGGC ACTGATAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 13026655..13027110 | 456..1 | 2235 | 99.3 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 17139446..17139905 | 460..1 | 2270 | 99.6 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 17140645..17141104 | 460..1 | 2270 | 99.5 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
blood | 7410 | blood BLOOD 7410bp | 6855..6936 | 315..391 | 128 | 65.9 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 13026655..13027110 | 1..456 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG43103-RA | 1..234 | 34..267 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG43103-RA | 1..234 | 34..267 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG43103-RA | 1..234 | 34..267 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG43103-RA | 21..475 | 1..455 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG43103-RA | 21..476 | 1..456 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG43103-RA | 27..482 | 1..456 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 17139450..17139905 | 1..456 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 17139450..17139905 | 1..456 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 17139450..17139905 | 1..456 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 13026955..13027410 | 1..456 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 17140649..17141104 | 1..456 | 99 | Minus |
Translation from 33 to 266
> FI14541.hyp MLSRSVLIVVGLLMLSWQWTMAMPPLPKNQPSGVSISQPDIPGASDILVQ SIFNIDPSLCPKGYIRTGPHHTCRRIA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG43103-PA | 77 | CG43103-PA | 1..77 | 1..77 | 409 | 100 | Plus |
Translation from 33 to 266
> FI14541.pep MLSRSVLIVVGLLMLSWQWTMAMPPLPKNQPSGVSISQPDIPGASDILVQ SIFNIDPSLCPKGYIRTGPHHTCRRIA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG22211-PA | 79 | GG22211-PA | 1..79 | 1..77 | 347 | 87.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG43103-PA | 77 | CG43103-PA | 1..77 | 1..77 | 409 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL17259-PA | 73 | GL17259-PA | 1..73 | 1..77 | 133 | 38 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA24153-PA | 73 | GA24153-PA | 1..73 | 1..77 | 136 | 38 | Plus |
Dpse\GA22239-PA | 73 | GA22239-PA | 1..73 | 1..77 | 133 | 38 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM20000-PA | 77 | GM20000-PA | 1..77 | 1..77 | 380 | 96.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD25491-PA | 77 | GD25491-PA | 1..77 | 1..77 | 391 | 98.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE14208-PA | 77 | GE14208-PA | 1..77 | 1..77 | 358 | 89.6 | Plus |