Clone FI14601 Report

Search the DGRC for FI14601

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:146
Well:1
Vector:pOT2
Associated Gene/TranscriptHand-RA
Protein status:FI14601.pep: gold
Sequenced Size:732

Clone Sequence Records

FI14601.complete Sequence

732 bp assembled on 2011-04-04

GenBank Submission: BT126289.1

> FI14601.complete
TCGAGTTTTACGTGCGACGCACTATCTGCGAAAATGTCGATCTTAAGCCG
CGAATTTGATTTGAATTTAATTACGTTAAATTAGAAAATGTTTAAGAATT
CCGTTGCCTTGACGTGCGAATACTCAACCATGTATTATAACTCAATTTAT
AATACTTCCAACATGTTCGACATGAAACACTCCGAAAGTCAAGTTCAGCA
ACAAATATATAACACAAGTCACCTAGGTTATGTGCCAACTTCGAATACTC
GGATTGTTAAGAAACGTAATACAGCTAACAAAAAGGAGAGAAGGCGAACC
CAAAGTATAAACAATGCGTTTTCCTATCTGCGAGAAAAGATTCCCAACGT
TCCTACAGATACTAAATTATCAAAGATTAAAACATTGAAGTTGGCCATAT
TGTACATAAACTATTTAGTTAATGTTCTTGATGGAGATCTGGATCCAAAA
GGCGGATTTCGAGCCGAACTTAAGCCGGTCAGTCGAAAGATCTGTAGCGA
AAAGAAGCACTGTTTGAAATCAGAGATTCAAAATGTTCCATTGTCGACCA
AGGGCCGCACGGGTTGGCCACAAGATGTTTGGGCATCGGAACTTATTCCA
GAACATAATTAAACCCATATTTTGCAAAAATAATATTTCATTCTATATAT
GTATATATATTGATAACCTATATTTAAAACAACAAGAAAAATAATAAACA
AATAAACAAGCAGTAAAAAAAAAAAAAAAAAA

FI14601.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:10:39
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 10293720..10293916 375..179 985 100 Minus
chr2L 23010047 chr2L 10291536..10291723 714..527 925 99.5 Minus
chr2L 23010047 chr2L 10294066..10294242 178..2 885 100 Minus
chr2L 23010047 chr2L 10293331..10293488 531..374 790 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:10:37
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10294863..10295059 375..179 985 100 Minus
2L 23513712 2L 10292674..10292866 719..527 935 99 Minus
2L 23513712 2L 10295209..10295385 178..2 885 100 Minus
2L 23513712 2L 10294474..10294631 531..374 790 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:10:19
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10294863..10295059 375..179 985 100 Minus
2L 23513712 2L 10292674..10292866 719..527 935 98.9 Minus
2L 23513712 2L 10295209..10295385 178..2 885 100 Minus
2L 23513712 2L 10294474..10294631 531..374 790 100 Minus
Blast to na_te.dros performed on 2019-03-16 23:10:37 has no hits.

FI14601.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:11:39 Download gff for FI14601.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 10293331..10293486 376..531 100 <- Minus
chr2L 10293720..10293916 179..375 100 <- Minus
chr2L 10294066..10294242 1..178 99   Minus
chr2L 10291536..10291718 532..714 100 <- Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-04-11 16:15:01 Download gff for FI14601.complete
Subject Subject Range Query Range Percent Splice Strand
Hand-RA 1..525 88..612 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:03:36 Download gff for FI14601.complete
Subject Subject Range Query Range Percent Splice Strand
Hand-RA 1..525 88..612 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:35:24 Download gff for FI14601.complete
Subject Subject Range Query Range Percent Splice Strand
Hand-RA 1..525 88..612 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-04-11 16:15:01 Download gff for FI14601.complete
Subject Subject Range Query Range Percent Splice Strand
Hand-RA 1..525 88..612 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:03:36 Download gff for FI14601.complete
Subject Subject Range Query Range Percent Splice Strand
Hand-RA 1..713 2..714 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:35:24 Download gff for FI14601.complete
Subject Subject Range Query Range Percent Splice Strand
Hand-RA 1..713 2..714 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:11:39 Download gff for FI14601.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10292679..10292861 532..714 100 <- Minus
2L 10294474..10294629 376..531 100 <- Minus
2L 10294863..10295059 179..375 100 <- Minus
2L 10295209..10295385 1..178 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:11:39 Download gff for FI14601.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10292679..10292861 532..714 100 <- Minus
2L 10294474..10294629 376..531 100 <- Minus
2L 10294863..10295059 179..375 100 <- Minus
2L 10295209..10295385 1..178 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:11:39 Download gff for FI14601.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10292679..10292861 532..714 100 <- Minus
2L 10294474..10294629 376..531 100 <- Minus
2L 10294863..10295059 179..375 100 <- Minus
2L 10295209..10295385 1..178 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:03:36 Download gff for FI14601.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10292679..10292861 532..714 100 <- Minus
arm_2L 10294474..10294629 376..531 100 <- Minus
arm_2L 10294863..10295059 179..375 100 <- Minus
arm_2L 10295209..10295385 1..178 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:04:32 Download gff for FI14601.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10294863..10295059 179..375 100 <- Minus
2L 10295209..10295385 1..178 99   Minus
2L 10292679..10292861 532..714 100 <- Minus
2L 10294474..10294629 376..531 100 <- Minus

FI14601.pep Sequence

Translation from 87 to 611

> FI14601.pep
MFKNSVALTCEYSTMYYNSIYNTSNMFDMKHSESQVQQQIYNTSHLGYVP
TSNTRIVKKRNTANKKERRRTQSINNAFSYLREKIPNVPTDTKLSKIKTL
KLAILYINYLVNVLDGDLDPKGGFRAELKPVSRKICSEKKHCLKSEIQNV
PLSTKGRTGWPQDVWASELIPEHN*

FI14601.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:45:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14118-PA 127 GF14118-PA 1..110 1..108 362 66.4 Plus
Dana\GF17655-PA 251 GF17655-PA 77..140 54..117 163 48.4 Plus
Dana\GF11672-PA 238 GF11672-PA 30..86 59..115 155 47.4 Plus
Dana\GF13559-PA 486 GF13559-PA 359..413 59..114 153 55.4 Plus
Dana\GF18852-PA 278 GF18852-PA 131..214 47..120 151 42.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:45:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23955-PA 174 GG23955-PA 1..174 1..174 897 95.4 Plus
Dere\GG13863-PA 251 GG13863-PA 77..140 54..117 163 48.4 Plus
Dere\GG21821-PA 241 GG21821-PA 32..88 59..115 158 47.4 Plus
Dere\twi-PA 489 GG22820-PA 362..416 59..114 153 55.4 Plus
Dere\GG20146-PA 279 GG20146-PA 148..228 59..129 148 44.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 18:45:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13020-PA 175 GH13020-PA 1..174 1..173 507 61 Plus
Dgri\GH19006-PA 262 GH19006-PA 77..140 54..117 162 48.4 Plus
Dgri\GH22024-PA 250 GH22024-PA 32..88 59..115 160 49.1 Plus
Dgri\GH20971-PA 526 GH20971-PA 392..465 59..132 157 48 Plus
Dgri\GH19315-PA 197 GH19315-PA 83..142 57..116 144 43.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:17:28
Subject Length Description Subject Range Query Range Score Percent Strand
Hand-PA 174 CG18144-PA 1..174 1..174 914 100 Plus
Fer1-PA 251 CG33323-PA 77..140 54..117 152 48.4 Plus
Fer1-PB 256 CG33323-PB 82..145 54..117 152 48.4 Plus
HLH54F-PA 242 CG5005-PA 32..88 59..115 150 47.4 Plus
Fer2-PE 273 CG5952-PE 148..210 59..120 145 52.4 Plus
Fer2-PB 274 CG5952-PB 148..210 59..120 145 52.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 18:45:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18263-PA 170 GI18263-PA 5..170 6..174 490 60.8 Plus
Dmoj\GI19113-PA 246 GI19113-PA 32..88 59..115 160 49.1 Plus
Dmoj\GI23061-PA 278 GI23061-PA 77..140 54..117 160 48.4 Plus
Dmoj\GI21307-PA 541 GI21307-PA 413..486 59..132 154 46.7 Plus
Dmoj\GI10095-PA 281 GI10095-PA 140..230 47..129 148 41.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 18:45:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18976-PA 173 GL18976-PA 12..173 14..174 544 65.4 Plus
Dper\GL12422-PA 253 GL12422-PA 77..140 54..117 162 48.4 Plus
Dper\GL17221-PA 233 GL17221-PA 32..88 59..115 158 47.4 Plus
Dper\GL11229-PA 510 GL11229-PA 379..451 59..131 155 45.9 Plus
Dper\GL18743-PA 206 GL18743-PA 137..205 50..117 147 43.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 18:45:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14815-PA 173 GA14815-PA 12..173 14..174 544 65.4 Plus
Dpse\GA27498-PA 253 GA27498-PA 77..140 54..117 162 48.4 Plus
Dpse\GA18588-PB 233 GA18588-PB 32..88 59..115 157 47.4 Plus
Dpse\twi-PA 510 GA15541-PA 379..451 59..131 155 45.9 Plus
Dpse\GA10296-PA 206 GA10296-PA 137..205 50..117 147 43.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:45:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11834-PA 171 GM11834-PA 1..171 1..174 882 96 Plus
Dsec\GM10936-PA 247 GM10936-PA 77..140 54..117 162 48.4 Plus
Dsec\GM21822-PA 242 GM21822-PA 32..88 59..115 158 47.4 Plus
Dsec\GM15978-PA 488 GM15978-PA 361..415 59..114 153 55.4 Plus
Dsec\GM25729-PA 279 GM25729-PA 148..228 59..129 148 44.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:45:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22284-PA 174 GD22284-PA 1..174 1..174 917 98.3 Plus
Dsim\GD19915-PA 251 GD19915-PA 77..140 54..117 163 48.4 Plus
Dsim\GD11315-PA 242 GD11315-PA 32..88 59..115 158 47.4 Plus
Dsim\twi-PA 476 GD11731-PA 349..403 59..114 152 55.4 Plus
Dsim\GD20306-PA 279 GD20306-PA 148..228 59..129 148 44.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 18:45:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17522-PA 133 GJ17522-PA 1..132 39..173 466 69.1 Plus
Dvir\GJ24574-PA 261 GJ24574-PA 77..140 54..117 161 48.4 Plus
Dvir\GJ22243-PA 245 GJ22243-PA 32..88 59..115 161 49.1 Plus
Dvir\twi-PA 522 GJ21576-PA 394..467 59..132 158 48 Plus
Dvir\GJ10284-PA 198 GJ10284-PA 85..144 57..116 144 43.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 18:45:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14521-PA 247 GK14521-PA 78..141 54..117 161 48.4 Plus
Dwil\GK22890-PA 262 GK22890-PA 32..88 59..115 155 47.4 Plus
Dwil\GK19547-PA 515 GK19547-PA 383..437 59..114 151 55.4 Plus
Dwil\GK11993-PA 198 GK11993-PA 85..144 57..116 144 43.3 Plus
Dwil\GK24655-PA 198 GK24655-PA 136..197 56..117 141 45.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:45:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26185-PA 174 GE26185-PA 1..174 1..174 898 96 Plus
Dyak\GE24907-PA 251 GE24907-PA 77..140 54..117 163 48.4 Plus
Dyak\GE11898-PA 249 GE11898-PA 32..88 59..115 157 47.4 Plus
Dyak\twi-PA 491 GE14255-PA 364..418 59..114 153 55.4 Plus
Dyak\GE26333-PA 279 GE26333-PA 148..228 59..129 148 44.4 Plus

FI14601.hyp Sequence

Translation from 87 to 611

> FI14601.hyp
MFKNSVALTCEYSTMYYNSIYNTSNMFDMKHSESQVQQQIYNTSHLGYVP
TSNTRIVKKRNTANKKERRRTQSINNAFSYLREKIPNVPTDTKLSKIKTL
KLAILYINYLVNVLDGDLDPKGGFRAELKPVSRKICSEKKHCLKSEIQNV
PLSTKGRTGWPQDVWASELIPEHN*

FI14601.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:24:35
Subject Length Description Subject Range Query Range Score Percent Strand
Hand-PA 174 CG18144-PA 1..174 1..174 914 100 Plus
Fer1-PA 251 CG33323-PA 77..140 54..117 152 48.4 Plus
Fer1-PB 256 CG33323-PB 82..145 54..117 152 48.4 Plus
HLH54F-PA 242 CG5005-PA 32..88 59..115 150 47.4 Plus
Fer2-PE 273 CG5952-PE 148..210 59..120 145 52.4 Plus