Clone FI14626 Report

Search the DGRC for FI14626

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:146
Well:26
Vector:pOT2
Associated Gene/Transcriptrobl62A-RA
Protein status:FI14626.pep: gold
Sequenced Size:578

Clone Sequence Records

FI14626.complete Sequence

578 bp assembled on 2011-04-04

GenBank Submission: BT126291.1

> FI14626.complete
ATACGGATCAAACATAACTAGAAAATAAATCTTTTAGACAATTTCTAATT
TCCAGTTTTACTACAAATCTTTTTCAAAATGTCGAAAATTTATCTGAAGG
CCATGGAGGATGTGGTGCAGCGAAACACGGACAACACAAACCGGATTACG
GAGCAGGCGCAGGGATTCGTGGTGTCGGAAAATGCCGGGGACAGTCTGCT
GCACACTTCATTCGATTTGACCACGGCCCAGTCGATTGTGAAGCACCTGC
ACGCCAGTTTCCTGAAATTGGCCCAGAGCTGCGTCCGTGATCTGGATACC
GATGATAAGCTGTGCTTTCTGCGCGTGAAAACCCGCAAGCACGAATTCCT
GGTTAGTCCAGAGGAAGCCTTCACTGTGACCGTGGTATTGTAATCCCCCA
GCCCATCTAGGGGTTAACAGTTTGGACATTGTTGCTTGCTGGTGGACAAG
GGAGAGAAACACCAATACACACCCACTATCGCTACAGCTGTCTCACTCGC
TCATTGTTGATGCTTTCGTTGAAGATCGTCGTACATGTTTAACCAACCCC
CCACCCCCCACCCATCCAAAAAAAAAAA

FI14626.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:10:52
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 1477171..1477736 1..564 2675 98.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:10:50
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 1477643..1478220 1..578 2875 99.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:10:21
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 1477643..1478220 1..578 2875 99.8 Plus
Blast to na_te.dros performed on 2019-03-16 23:10:50 has no hits.

FI14626.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:11:45 Download gff for FI14626.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 1477171..1477738 1..567 98   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-04-11 16:15:03 Download gff for FI14626.complete
Subject Subject Range Query Range Percent Splice Strand
robl62A-RA 1..315 79..393 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:03:42 Download gff for FI14626.complete
Subject Subject Range Query Range Percent Splice Strand
robl62A-RA 1..315 79..393 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:35:29 Download gff for FI14626.complete
Subject Subject Range Query Range Percent Splice Strand
robl62A-RA 1..315 79..393 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-04-11 16:15:03 Download gff for FI14626.complete
Subject Subject Range Query Range Percent Splice Strand
robl62A-RA 25..591 1..567 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:03:42 Download gff for FI14626.complete
Subject Subject Range Query Range Percent Splice Strand
robl62A-RA 25..591 1..567 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:35:29 Download gff for FI14626.complete
Subject Subject Range Query Range Percent Splice Strand
robl62A-RA 25..591 1..567 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:11:45 Download gff for FI14626.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1477643..1478209 1..567 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:11:45 Download gff for FI14626.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1477643..1478209 1..567 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:11:45 Download gff for FI14626.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1477643..1478209 1..567 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:03:42 Download gff for FI14626.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 1477643..1478209 1..567 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:04:35 Download gff for FI14626.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1477643..1478209 1..567 100   Plus

FI14626.pep Sequence

Translation from 78 to 392

> FI14626.pep
MSKIYLKAMEDVVQRNTDNTNRITEQAQGFVVSENAGDSLLHTSFDLTTA
QSIVKHLHASFLKLAQSCVRDLDTDDKLCFLRVKTRKHEFLVSPEEAFTV
TVVL*

FI14626.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:46:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24767-PA 104 GF24767-PA 1..104 1..104 443 78.8 Plus
Dana\GF17923-PA 101 GF17923-PA 3..100 7..103 248 46.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:46:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14793-PA 104 GG14793-PA 1..104 1..104 518 95.2 Plus
Dere\GG16811-PA 101 GG16811-PA 3..100 7..103 246 48 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 18:46:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19470-PA 101 GH19470-PA 3..100 7..103 267 51 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:54:41
Subject Length Description Subject Range Query Range Score Percent Strand
robl62A-PB 104 CG1014-PB 1..104 1..104 523 100 Plus
robl62A-PA 104 CG1014-PA 1..104 1..104 523 100 Plus
CG31275-PA 101 CG31275-PA 3..100 7..103 243 49 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 18:46:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24707-PA 101 GI24707-PA 3..100 7..103 271 53.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 18:46:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22509-PA 104 GL22509-PA 1..104 1..104 345 62.5 Plus
Dper\GL23003-PA 101 GL23003-PA 3..100 7..103 268 52 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 18:46:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10103-PA 104 GA10103-PA 1..104 1..104 337 61.5 Plus
Dpse\GA16143-PA 101 GA16143-PA 3..100 7..103 272 53.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:46:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14415-PA 104 GM14415-PA 1..104 1..104 534 98.1 Plus
Dsec\GM15406-PA 101 GM15406-PA 3..100 7..103 254 49 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:46:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13620-PA 104 GD13620-PA 1..104 1..104 534 98.1 Plus
Dsim\GD20269-PA 101 GD20269-PA 3..100 7..103 254 49 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 18:46:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23924-PA 101 GJ23924-PA 3..100 7..103 273 53.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 18:46:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13854-PA 101 GK13854-PA 3..100 7..103 274 49 Plus
Dwil\GK16985-PA 152 GK16985-PA 1..84 1..85 272 60 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:46:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21156-PA 104 GE21156-PA 1..104 1..104 518 95.2 Plus
Dyak\GE26128-PA 101 GE26128-PA 3..100 7..103 250 48 Plus

FI14626.hyp Sequence

Translation from 78 to 392

> FI14626.hyp
MSKIYLKAMEDVVQRNTDNTNRITEQAQGFVVSENAGDSLLHTSFDLTTA
QSIVKHLHASFLKLAQSCVRDLDTDDKLCFLRVKTRKHEFLVSPEEAFTV
TVVL*

FI14626.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:24:44
Subject Length Description Subject Range Query Range Score Percent Strand
robl62A-PB 104 CG1014-PB 1..104 1..104 523 100 Plus
robl62A-PA 104 CG1014-PA 1..104 1..104 523 100 Plus
CG31275-PA 101 CG31275-PA 3..100 7..103 243 49 Plus