Clone FI14712 Report

Search the DGRC for FI14712

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:147
Well:12
Vector:pCR2.1
Associated Gene/TranscriptAld-RH
Protein status:FI14712.pep: gold
Sequenced Size:1207

Clone Sequence Records

FI14712.complete Sequence

1207 bp assembled on 2011-04-08

GenBank Submission: BT126303.1

> FI14712.complete
CCAGTAGCCAGCAGCTAGGCACCACATCCCAGATTCAGTTTCCAGTTCGA
ACTACACTCGAATCTCAAAAATGACGACCTACTTCAACTACCCCAGCAAG
GAGCTGCAGGATGAGCTGCGCGAAATCGCCCAGAAAATCGTTGCCCCCGG
CAAGGGAATCCTCGCCGCCGATGAGTCCGGCCCAACCATGGGCAAGCGTC
TGCAGGACATCGGCGTGGAGAACACCGAGGACAACCGCCGTGCCTACCGT
CAGCTGTTGTTCAGCACTGACCCCAAGCTGGCCGAGAACATCTCTGGAGT
GATCCTGTTCCACGAGACCCTCTACCAGAAGGCCGATGATGGCACCCCCT
TCGCCGAGATCCTGAAGAAGAAGGGAATCATTCTGGGCATCAAGGTCGAC
AAGGGTGTTGTCCCACTGTTCGGCTCTGAGGATGAGGTCACCACCCAGGG
TCTGGATGACCTGGCCGCCCGTTGCGCCCAGTACAAGAAGGACGGTTGCG
ACTTCGCCAAGTGGCGTTGCGTCCTGAAGATCGGCAAGAACACCCCATCC
TACCAGTCGATCCTGGAGAACGCCAATGTCCTGGCCCGCTACGCCTCCAT
CTGCCAGTCGCAGCGCATCGTCCCAATTGTGGAGCCCGAGGTTCTGCCCG
ATGGCGATCACGATCTGGACCGCGCCCAGAAGGTCACCGAGACCGTCCTG
GCCGCCGTCTACAAGGCCCTGAGCGACCACCACGTCTACCTGGAGGGTAC
TCTGCTGAAGCCCAACATGGTCACCGCCGGTCAGTCGGCCAAGAAGAACA
CCCCCGAGGAGATCGCCCTGGCCACCGTGCAGGCTCTGCGCCGCACCGTT
CCCGCCGCCGTTACTGGCGTGACCTTCCTGTCTGGAGGTCAGTCCGAGGA
GGAGGCCACCGTCAACCTGAGTGCCATCAACAACGTTCCCTTGATCCGCC
CATGGGCCCTCACCTTCTCGTACGGTCGTGCCCTGCAGGCCTCCGTCCTG
CGTGCCTGGGCTGGCAAGAAGGAGAACATTGCTGCCGGCCAGAACGAGCT
GCTTAAGCGCGCCAAGGCCAATTCCCAGGCCTGTCAGGGTATTTACGTGC
CCGGCTCAATTCCGTCGTTTGCCGGCAATGCCAACCTCTTTGTCGCCCAG
CACAAATACTAAGTCCTAAATGCCACGCACTAATCCCGAGTCACAATCGA
GCGAAGC

FI14712.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:15:29
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 22080278..22081096 867..49 4050 99.6 Minus
chr3R 27901430 chr3R 22079986..22080191 1067..862 1000 99 Minus
chr3R 27901430 chr3R 22079221..22079363 1207..1065 700 99.3 Minus
chr3R 27901430 chr3R 22237241..22237860 152..771 505 72.1 Plus
chr3R 27901430 chr3R 22084392..22084440 49..1 215 95.9 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:15:27
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 26257224..26258042 867..49 4095 100 Minus
3R 32079331 3R 26256932..26257137 1067..862 1015 99.5 Minus
3R 32079331 3R 26256167..26256309 1207..1065 715 100 Minus
3R 32079331 3R 26414213..26414832 152..771 505 72.1 Plus
3R 32079331 3R 26261336..26261384 49..1 215 95.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:10:50
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 25998055..25998873 867..49 4095 100 Minus
3R 31820162 3R 25997763..25997968 1067..862 1015 99.5 Minus
3R 31820162 3R 25996998..25997140 1207..1065 715 100 Minus
3R 31820162 3R 26155305..26155424 413..532 315 84.1 Plus
3R 31820162 3R 26002167..26002215 49..1 215 95.9 Minus
3R 31820162 3R 26155044..26155132 152..240 160 78.6 Plus
Blast to na_te.dros performed on 2019-03-16 23:15:28 has no hits.

FI14712.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:16:11 Download gff for FI14712.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 22079987..22080186 867..1066 99 <- Minus
chr3R 22079221..22079361 1067..1207 99 <- Minus
chr3R 22080279..22081095 50..866 99 <- Minus
chr3R 22084392..22084440 1..49 95   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-04-11 16:15:26 Download gff for FI14712.complete
Subject Subject Range Query Range Percent Splice Strand
Ald-RH 1..1092 71..1162 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:05:09 Download gff for FI14712.complete
Subject Subject Range Query Range Percent Splice Strand
Ald-RH 1..1092 71..1162 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:36:40 Download gff for FI14712.complete
Subject Subject Range Query Range Percent Splice Strand
Ald-RH 1..1092 71..1162 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-04-11 16:15:25 Download gff for FI14712.complete
Subject Subject Range Query Range Percent Splice Strand
Ald-RH 167..1329 44..1207 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:05:09 Download gff for FI14712.complete
Subject Subject Range Query Range Percent Splice Strand
Ald-RL 208..1414 1..1207 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:36:40 Download gff for FI14712.complete
Subject Subject Range Query Range Percent Splice Strand
Ald-RL 208..1414 1..1207 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:16:11 Download gff for FI14712.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26256167..26256307 1067..1207 100 <- Minus
3R 26256933..26257132 867..1066 100 <- Minus
3R 26257225..26258041 50..866 100 <- Minus
3R 26261336..26261384 1..49 95   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:16:11 Download gff for FI14712.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26256167..26256307 1067..1207 100 <- Minus
3R 26256933..26257132 867..1066 100 <- Minus
3R 26257225..26258041 50..866 100 <- Minus
3R 26261336..26261384 1..49 95   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:16:11 Download gff for FI14712.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26256167..26256307 1067..1207 100 <- Minus
3R 26256933..26257132 867..1066 100 <- Minus
3R 26257225..26258041 50..866 100 <- Minus
3R 26261336..26261384 1..49 95   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:05:09 Download gff for FI14712.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 22081889..22082029 1067..1207 100 <- Minus
arm_3R 22082655..22082854 867..1066 100 <- Minus
arm_3R 22082947..22083763 50..866 100 <- Minus
arm_3R 22087058..22087106 1..49 95   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:05:33 Download gff for FI14712.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25997764..25997963 867..1066 100 <- Minus
3R 25998056..25998872 50..866 100 <- Minus
3R 26002167..26002215 1..49 95   Minus
3R 25996998..25997138 1067..1207 100 <- Minus

FI14712.pep Sequence

Translation from 70 to 1161

> FI14712.pep
MTTYFNYPSKELQDELREIAQKIVAPGKGILAADESGPTMGKRLQDIGVE
NTEDNRRAYRQLLFSTDPKLAENISGVILFHETLYQKADDGTPFAEILKK
KGIILGIKVDKGVVPLFGSEDEVTTQGLDDLAARCAQYKKDGCDFAKWRC
VLKIGKNTPSYQSILENANVLARYASICQSQRIVPIVEPEVLPDGDHDLD
RAQKVTETVLAAVYKALSDHHVYLEGTLLKPNMVTAGQSAKKNTPEEIAL
ATVQALRRTVPAAVTGVTFLSGGQSEEEATVNLSAINNVPLIRPWALTFS
YGRALQASVLRAWAGKKENIAAGQNELLKRAKANSQACQGIYVPGSIPSF
AGNANLFVAQHKY*

FI14712.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:45:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16038-PA 363 GF16038-PA 1..363 1..363 1725 90.9 Plus
Dana\GF20732-PA 364 GF20732-PA 1..359 1..358 1388 71.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:45:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12193-PA 363 GG12193-PA 1..363 1..363 1828 94.8 Plus
Dere\GG11473-PA 364 GG11473-PA 1..358 1..357 1346 69 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 18:46:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18178-PA 363 GH18178-PA 1..363 1..363 1638 85.4 Plus
Dgri\GH19415-PA 364 GH19415-PA 1..359 1..358 1383 71.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:11:18
Subject Length Description Subject Range Query Range Score Percent Strand
Ald-PJ 363 CG6058-PJ 1..363 1..363 1855 100 Plus
Ald-PL 363 CG6058-PL 1..363 1..363 1855 100 Plus
Ald-PH 363 CG6058-PH 1..363 1..363 1855 100 Plus
Ald-PM 361 CG6058-PM 1..361 1..363 1761 96.1 Plus
Ald-PK 361 CG6058-PK 1..361 1..363 1761 96.1 Plus
Ald-PD 361 CG6058-PD 1..361 1..363 1761 96.1 Plus
Ald-PC 361 CG6058-PC 1..361 1..363 1761 96.1 Plus
Ald-PB 361 CG6058-PB 1..361 1..363 1761 96.1 Plus
Ald-PI 363 CG6058-PI 1..363 1..363 1760 95.3 Plus
Ald-PE 363 CG6058-PE 1..363 1..363 1760 95.3 Plus
CG5432-PB 364 CG5432-PB 1..357 1..356 1279 69.5 Plus
CG5432-PA 364 CG5432-PA 1..357 1..356 1279 69.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 18:46:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10131-PA 361 GI10131-PA 1..361 1..363 1602 84.3 Plus
Dmoj\GI22619-PA 364 GI22619-PA 1..359 1..358 1392 71.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 18:46:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21844-PA 364 GL21844-PA 1..364 1..363 1328 67.3 Plus
Dper\GL22000-PA 319 GL22000-PA 1..178 1..177 758 84.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 18:46:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19329-PB 363 GA19329-PB 1..363 1..363 1791 92.6 Plus
Dpse\GA19329-PC 361 GA19329-PC 1..361 1..363 1736 90.9 Plus
Dpse\GA19329-PD 363 GA19329-PD 1..363 1..363 1731 90.6 Plus
Dpse\GA18877-PA 364 GA18877-PA 1..364 1..363 1332 67.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:46:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10189-PA 363 GM10189-PA 1..363 1..363 1933 99.7 Plus
Dsec\GM10318-PA 364 GM10318-PA 1..358 1..357 1342 69.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:46:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18141-PA 363 GD18141-PA 1..363 1..363 1929 99.4 Plus
Dsim\GD21278-PA 354 GD21278-PA 1..348 1..357 1260 66.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 18:46:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23350-PA 363 GJ23350-PA 1..363 1..363 1636 84.6 Plus
Dvir\GJ23865-PA 364 GJ23865-PA 1..359 1..358 1441 73 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 18:46:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13316-PA 386 GK13316-PA 1..386 1..363 1716 86 Plus
Dwil\GK13312-PA 364 GK13312-PA 1..364 1..363 1410 69.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:46:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10635-PA 363 GE10635-PA 1..363 1..363 1925 99.2 Plus
Dyak\GE23665-PA 364 GE23665-PA 1..358 1..357 1346 69 Plus

FI14712.hyp Sequence

Translation from 70 to 1161

> FI14712.hyp
MTTYFNYPSKELQDELREIAQKIVAPGKGILAADESGPTMGKRLQDIGVE
NTEDNRRAYRQLLFSTDPKLAENISGVILFHETLYQKADDGTPFAEILKK
KGIILGIKVDKGVVPLFGSEDEVTTQGLDDLAARCAQYKKDGCDFAKWRC
VLKIGKNTPSYQSILENANVLARYASICQSQRIVPIVEPEVLPDGDHDLD
RAQKVTETVLAAVYKALSDHHVYLEGTLLKPNMVTAGQSAKKNTPEEIAL
ATVQALRRTVPAAVTGVTFLSGGQSEEEATVNLSAINNVPLIRPWALTFS
YGRALQASVLRAWAGKKENIAAGQNELLKRAKANSQACQGIYVPGSIPSF
AGNANLFVAQHKY*

FI14712.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:26:58
Subject Length Description Subject Range Query Range Score Percent Strand
Ald-PJ 363 CG6058-PJ 1..363 1..363 1855 100 Plus
Ald-PL 363 CG6058-PL 1..363 1..363 1855 100 Plus
Ald-PH 363 CG6058-PH 1..363 1..363 1855 100 Plus
Ald-PM 361 CG6058-PM 1..361 1..363 1761 96.1 Plus
Ald-PK 361 CG6058-PK 1..361 1..363 1761 96.1 Plus