Clone FI14849 Report

Search the DGRC for FI14849

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:148
Well:49
Vector:pCR2.1
Associated Gene/TranscriptCG33985-RA
Protein status:FI14849.pep: gold
Sequenced Size:870

Clone Sequence Records

FI14849.complete Sequence

870 bp assembled on 2011-04-04

GenBank Submission: BT126267.1

> FI14849.complete
AGAAGATGTTTGGAGTATTGAAGTTTGGATCCATCCTGGTGTCCCTCCTA
TTTCTGGCCACCAGTCATGCGGATGTTTTCGATGAGTGTAACGATGGTAA
CAACCTATCCTTTGTTACTTCGCCAAAGAGTTGCGCACATTATATCTTCT
GCAACGGCGATGAGTCATACGATGGTGAATGCGAGGATGGCGAATACTTT
AGTCAAGATATGGAAATGTGTGAGCCCATGGGCGATATCGACTGTCGCAC
GGGATCGGAGGTGCAAAGGGAAAACACTACCGACAGCTCCTCAACGGAGA
TTACCTCGGAGTCCAGTACGATTTCCACAGTTGTAATCACCACATTAGCC
CCATCGGCAGTGGTCACATTACGACCATCAGTCAATCAAAGTGGAGCCAG
CAGTACGACTTCCGTATCGCCTGCTATAGAGATTATTGTGACCAATGTGT
GCCCACAACTGGATAATCAGAGTCGTATCGCATTGCTGCCAAATCAGAAC
TCCTGTTCAGATTATTACATTTGCTATCGCGGTGTGGCACTTCCCATGAG
TTGTGCCACCAGTTTGCACTTTAATTCACTCACCGGAAAATGCGATCATC
CCGAAAACGTTAGGTGTTTGGCCATGACTTATAATCCCAGGGAGCAGTGC
AAGCGACATGTAATCGATGTTTATCCGCATTCCGACAACTGCAATTACTT
TTACCAGTGTCGCTCTGGCTATTTGATGGTCCAGCAGTGTCCTTTCTTCT
ACGGATGGGACTACGAGAAGCGATCCTGTGTAGCACTAGGTCAAGCCAAA
TGCTACAACAAGCTGCAAATGCAAATGAAAATTTATTAAATACACATAAT
AATATTTATTAAAAAAAAAA

FI14849.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:14:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 15516130..15516750 621..1 3045 99.4 Minus
chr3L 24539361 chr3L 15515829..15516069 860..620 1205 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:14:20
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15526192..15526812 621..1 3105 100 Minus
3L 28110227 3L 15525881..15526131 870..620 1255 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:10:31
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 15519292..15519912 621..1 3105 100 Minus
3L 28103327 3L 15518981..15519231 870..620 1255 100 Minus
Blast to na_te.dros performed on 2019-03-16 23:14:20 has no hits.

FI14849.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:15:42 Download gff for FI14849.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 15515863..15516068 621..826 100 <- Minus
chr3L 15516131..15516750 1..620 99   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-04-11 16:15:15 Download gff for FI14849.complete
Subject Subject Range Query Range Percent Splice Strand
CG33985-RA 1..834 6..839 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:04:26 Download gff for FI14849.complete
Subject Subject Range Query Range Percent Splice Strand
CG33985-RA 1..834 6..839 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:35:59 Download gff for FI14849.complete
Subject Subject Range Query Range Percent Splice Strand
CG33985-RA 1..834 6..839 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-04-11 16:15:15 Download gff for FI14849.complete
Subject Subject Range Query Range Percent Splice Strand
CG33985-RA 1..855 6..860 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:04:26 Download gff for FI14849.complete
Subject Subject Range Query Range Percent Splice Strand
CG33985-RA 1..860 1..860 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:35:59 Download gff for FI14849.complete
Subject Subject Range Query Range Percent Splice Strand
CG33985-RA 1..860 1..860 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:15:42 Download gff for FI14849.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15525891..15526130 621..860 100 <- Minus
3L 15526193..15526812 1..620 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:15:42 Download gff for FI14849.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15525891..15526130 621..860 100 <- Minus
3L 15526193..15526812 1..620 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:15:42 Download gff for FI14849.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15525891..15526130 621..860 100 <- Minus
3L 15526193..15526812 1..620 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:04:26 Download gff for FI14849.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15518991..15519230 621..860 100 <- Minus
arm_3L 15519293..15519912 1..620 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:04:56 Download gff for FI14849.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15518991..15519230 621..860 100 <- Minus
3L 15519293..15519912 1..620 100   Minus

FI14849.pep Sequence

Translation from 2 to 838

> FI14849.pep
KMFGVLKFGSILVSLLFLATSHADVFDECNDGNNLSFVTSPKSCAHYIFC
NGDESYDGECEDGEYFSQDMEMCEPMGDIDCRTGSEVQRENTTDSSSTEI
TSESSTISTVVITTLAPSAVVTLRPSVNQSGASSTTSVSPAIEIIVTNVC
PQLDNQSRIALLPNQNSCSDYYICYRGVALPMSCATSLHFNSLTGKCDHP
ENVRCLAMTYNPREQCKRHVIDVYPHSDNCNYFYQCRSGYLMVQQCPFFY
GWDYEKRSCVALGQAKCYNKLQMQMKIY*

FI14849.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:41:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24469-PA 290 GF24469-PA 1..288 2..275 977 61.7 Plus
Dana\GF24464-PA 259 GF24464-PA 6..253 11..268 452 38.9 Plus
Dana\GF19890-PA 232 GF19890-PA 1..225 2..277 234 25.4 Plus
Dana\GF24468-PA 266 GF24468-PA 121..265 152..277 214 32.4 Plus
Dana\GF10954-PA 192 GF10954-PA 135..191 213..269 142 40.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:41:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13541-PA 274 GG13541-PA 5..274 8..278 1333 90.4 Plus
Dere\GG13539-PA 273 GG13539-PA 8..253 11..269 464 36.2 Plus
Dere\GG11181-PA 221 GG11181-PA 1..210 2..276 218 25 Plus
Dere\GG13542-PA 290 GG13542-PA 62..285 37..273 206 23.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 18:41:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16815-PA 281 GH16815-PA 26..277 21..276 652 47.3 Plus
Dgri\GH16813-PA 241 GH16813-PA 5..235 10..268 480 36.7 Plus
Dgri\GH16816-PA 250 GH16816-PA 51..247 36..273 164 25 Plus
Dgri\GH15116-PA 316 GH15116-PA 159..316 37..209 145 26 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:32:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG33985-PA 277 CG33985-PA 1..277 2..278 1497 100 Plus
obst-H-PA 269 CG33983-PA 12..248 15..268 519 37.6 Plus
CG13837-PA 223 CG13837-PA 2..208 4..270 256 28.4 Plus
CG33986-PB 277 CG33986-PB 49..272 37..273 236 24.8 Plus
CG33263-PA 227 CG33263-PA 5..224 6..269 232 24.9 Plus
CG10140-PA 297 CG10140-PA 47..289 18..259 155 19.6 Plus
CG4835-PB 1224 CG4835-PB 482..692 27..246 155 24.6 Plus
Muc68E-PA 1799 CG33265-PA 1555..1731 83..259 152 27.9 Plus
CG11570-PC 262 CG11570-PC 38..149 150..269 149 27.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 18:41:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12219-PA 271 GI12219-PA 18..266 24..270 615 46.6 Plus
Dmoj\GI12216-PA 257 GI12216-PA 11..251 12..268 452 36.6 Plus
Dmoj\GI12221-PA 269 GI12221-PA 46..266 29..273 209 26.4 Plus
Dmoj\GI13784-PA 302 GI13784-PA 43..293 13..259 148 23.7 Plus
Dmoj\GI13788-PA 193 GI13788-PA 136..192 213..269 141 38.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 18:41:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25573-PA 271 GL25573-PA 8..271 11..274 872 61.1 Plus
Dper\GL25551-PA 260 GL25551-PA 8..254 11..268 470 37.5 Plus
Dper\GL27122-PA 239 GL27122-PA 10..229 8..278 229 26.9 Plus
Dper\GL25584-PA 267 GL25584-PA 35..254 37..267 222 24.7 Plus
Dper\GL25433-PA 196 GL25433-PA 134..192 213..271 162 42.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 18:41:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23637-PA 271 GA23637-PA 8..271 11..274 866 60.8 Plus
Dpse\GA20733-PA 258 GA20733-PA 8..252 11..268 467 38.2 Plus
Dpse\GA12560-PA 240 GA12560-PA 10..230 8..278 222 26.2 Plus
Dpse\GA23638-PA 267 GA23638-PA 35..254 37..267 221 24.7 Plus
Dpse\GA28616-PA 196 GA28616-PA 134..192 213..271 162 42.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:41:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24484-PA 276 GM24484-PA 1..276 2..278 1345 91.7 Plus
Dsec\GM24482-PA 269 GM24482-PA 6..248 11..268 461 36.4 Plus
Dsec\GM26480-PA 226 GM26480-PA 10..213 10..273 249 29.7 Plus
Dsec\GM24485-PA 274 GM24485-PA 132..269 152..273 211 33.3 Plus
Dsec\GM24595-PA 227 GM24595-PA 10..224 11..269 200 23.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:41:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12556-PA 276 GD12556-PA 1..276 2..278 1343 91.7 Plus
Dsim\GD17570-PA 127 GD17570-PA 1..106 162..268 324 52.8 Plus
Dsim\GD15179-PA 225 GD15179-PA 1..212 2..273 255 29.9 Plus
Dsim\GD12557-PA 279 GD12557-PA 51..274 37..273 217 25.6 Plus
Dsim\GD12664-PA 226 GD12664-PA 10..225 11..270 207 23.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 18:41:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11450-PA 271 GJ11450-PA 22..270 23..273 639 46.9 Plus
Dvir\GJ11448-PA 252 GJ11448-PA 5..246 10..268 493 37.9 Plus
Dvir\GJ11451-PA 268 GJ11451-PA 52..265 36..273 234 26.7 Plus
Dvir\GJ13591-PA 180 GJ13591-PA 123..179 213..269 147 38.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 18:41:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10521-PA 276 GK10521-PA 23..271 24..269 684 51.8 Plus
Dwil\GK10516-PA 272 GK10516-PA 5..270 5..272 481 38.2 Plus
Dwil\GK19192-PA 240 GK19192-PA 32..225 26..268 252 26.3 Plus
Dwil\GK10520-PA 286 GK10520-PA 59..283 37..277 227 25.4 Plus
Dwil\GK17083-PA 194 GK17083-PA 135..194 212..271 146 40 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:41:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22841-PA 274 GE22841-PA 1..274 2..278 1359 91.7 Plus
Dyak\GE19842-PA 274 GE19842-PA 1..274 2..278 1359 92.1 Plus
Dyak\GE22838-PA 271 GE22838-PA 16..260 19..277 467 37.9 Plus
Dyak\GE19840-PA 271 GE19840-PA 16..260 19..277 467 37.9 Plus
Dyak\GE10346-PA 226 GE10346-PA 1..213 2..273 242 28.5 Plus

FI14849.hyp Sequence

Translation from 2 to 838

> FI14849.hyp
KMFGVLKFGSILVSLLFLATSHADVFDECNDGNNLSFVTSPKSCAHYIFC
NGDESYDGECEDGEYFSQDMEMCEPMGDIDCRTGSEVQRENTTDSSSTEI
TSESSTISTVVITTLAPSAVVTLRPSVNQSGASSTTSVSPAIEIIVTNVC
PQLDNQSRIALLPNQNSCSDYYICYRGVALPMSCATSLHFNSLTGKCDHP
ENVRCLAMTYNPREQCKRHVIDVYPHSDNCNYFYQCRSGYLMVQQCPFFY
GWDYEKRSCVALGQAKCYNKLQMQMKIY*

FI14849.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:26:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG33985-PA 277 CG33985-PA 1..277 2..278 1497 100 Plus
obst-H-PA 269 CG33983-PA 12..248 15..268 519 37.6 Plus
CG13837-PA 223 CG13837-PA 2..208 4..270 256 28.4 Plus
CG33986-PB 277 CG33986-PB 49..272 37..273 236 24.8 Plus
CG33263-PA 227 CG33263-PA 5..224 6..269 232 24.9 Plus