Clone FI15201 Report

Search the DGRC for FI15201

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:152
Well:1
Vector:pOT2
Associated Gene/TranscriptCG13064-RA
Protein status:FI15201.pep: gold
Sequenced Size:354

Clone Sequence Records

FI15201.complete Sequence

354 bp assembled on 2011-08-22

GenBank Submission: BT128822.1

> FI15201.complete
CCACAATATCACCAGAGAATGTTCAAGCTCGTCGTGCTATTCGGCCTTTT
GAGTGGTGCCTTTGCCGCCACGGTTATCTACCATCACCCGGTGATCTATC
ATCATCCTCTGCCGGTTGCATCAACGCCCCAGGAGTTGGCTCAGCATCCT
GGCTACACCATTGTGGCACCTCTCACGAAGATTGCCCACGTCACCTACGA
TTCGGTGCCCATTTCGCACACGCCCTACGAACATGTTCCTCTCTTCCAGA
GGATTGGTCATGTCAAAAACATTAGGTTCTAGCGATGTATACCCTAGAAA
AACATAGTTTAACTTATAAATAAAAACAAATAATAATAAAAAAAAAAAAA
AAAA

FI15201.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 10:56:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 16270257..16270565 26..337 1415 98.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 10:56:31
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16280549..16280862 26..339 1570 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:00:54
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 16273649..16273962 26..339 1570 100 Plus
3L 28103327 3L 16273561..16273587 1..27 135 100 Plus
Blast to na_te.dros performed 2019-03-15 10:56:32
Subject Length Description Subject Range Query Range Score Percent Strand
TAHRE 10463 TAHRE OSV 10463bp 8450..8533 256..337 127 64.7 Plus
TAHRE 10463 TAHRE OSV 10463bp 9363..9427 268..337 103 67.1 Plus
accord2 7650 accord2 QBERT 7650bp 6247..6281 332..298 103 77.1 Minus
transib2 2844 transib2 TRANSIB2 2844bp 46..119 258..336 103 64.6 Plus
HeT-A 6083 HeT-A DM06920 6083bp Derived from U06920.2 (Rel. 67, Last updated, Version 14). 5187..5226 297..336 101 72.5 Plus

FI15201.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 10:57:19 Download gff for FI15201.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 16270169..16270195 1..27 100 -> Plus
chr3L 16270259..16270542 28..315 98   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-08-22 15:25:26 Download gff for FI15201.complete
Subject Subject Range Query Range Percent Splice Strand
CG13064-RA 1..264 19..282 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:30:03 Download gff for FI15201.complete
Subject Subject Range Query Range Percent Splice Strand
CG13064-RA 1..264 19..282 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:16:24 Download gff for FI15201.complete
Subject Subject Range Query Range Percent Splice Strand
CG13064-RA 1..264 19..282 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-22 15:25:25 Download gff for FI15201.complete
Subject Subject Range Query Range Percent Splice Strand
CG13064-RA 1..264 19..282 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:30:03 Download gff for FI15201.complete
Subject Subject Range Query Range Percent Splice Strand
CG13064-RA 58..372 1..315 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:16:24 Download gff for FI15201.complete
Subject Subject Range Query Range Percent Splice Strand
CG13064-RA 58..372 1..315 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:57:19 Download gff for FI15201.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16280461..16280487 1..27 100 -> Plus
3L 16280551..16280838 28..315 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:57:19 Download gff for FI15201.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16280461..16280487 1..27 100 -> Plus
3L 16280551..16280838 28..315 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:57:19 Download gff for FI15201.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16280461..16280487 1..27 100 -> Plus
3L 16280551..16280838 28..315 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:30:03 Download gff for FI15201.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16273561..16273587 1..27 100 -> Plus
arm_3L 16273651..16273938 28..315 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:47:01 Download gff for FI15201.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16273651..16273938 28..315 100   Plus
3L 16273561..16273587 1..27 100 -> Plus

FI15201.hyp Sequence

Translation from 0 to 281

> FI15201.hyp
PQYHQRMFKLVVLFGLLSGAFAATVIYHHPVIYHHPLPVASTPQELAQHP
GYTIVAPLTKIAHVTYDSVPISHTPYEHVPLFQRIGHVKNIRF*

FI15201.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:18:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG13064-PA 87 CG13064-PA 1..87 7..93 465 100 Plus

FI15201.pep Sequence

Translation from 0 to 281

> FI15201.pep
PQYHQRMFKLVVLFGLLSGAFAATVIYHHPVIYHHPLPVASTPQELAQHP
GYTIVAPLTKIAHVTYDSVPISHTPYEHVPLFQRIGHVKNIRF*

FI15201.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:26:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24174-PA 82 GF24174-PA 1..82 13..93 350 85.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:26:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15979-PA 87 GG15979-PA 1..87 7..93 406 93.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 19:26:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15870-PA 94 GH15870-PA 5..94 7..93 258 62.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:08:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG13064-PA 87 CG13064-PA 1..87 7..93 465 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 19:26:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12651-PA 89 GI12651-PA 10..89 11..93 267 68.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:26:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17846-PA 94 GL17846-PA 3..87 7..92 252 66.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:26:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28510-PA 87 GA28510-PA 3..80 10..92 254 69.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:26:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25612-PA 87 GM25612-PA 18..87 24..93 351 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:26:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14616-PA 87 GD14616-PA 1..87 7..93 413 94.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:26:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12772-PA 93 GJ12772-PA 10..93 8..93 255 64.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 19:26:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19251-PA 87 GK19251-PA 7..87 20..93 265 70.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:26:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19546-PA 87 GE19546-PA 1..87 7..93 396 90.8 Plus
Dyak\GE23175-PA 87 GE23175-PA 1..87 7..93 396 90.8 Plus