BDGP Sequence Production Resources |
Search the DGRC for FI15201
Library: | FI |
Tissue Source: | various Drosophila melanogaster |
Created by: | |
Date Registered: | 2005-11-08 |
Comments: | Drosophila melanogaster corrected cDNA clones |
Original Plate Number: | 152 |
Well: | 1 |
Vector: | pOT2 |
Associated Gene/Transcript | CG13064-RA |
Protein status: | FI15201.pep: gold |
Sequenced Size: | 354 |
354 bp assembled on 2011-08-22
GenBank Submission: BT128822.1
> FI15201.complete CCACAATATCACCAGAGAATGTTCAAGCTCGTCGTGCTATTCGGCCTTTT GAGTGGTGCCTTTGCCGCCACGGTTATCTACCATCACCCGGTGATCTATC ATCATCCTCTGCCGGTTGCATCAACGCCCCAGGAGTTGGCTCAGCATCCT GGCTACACCATTGTGGCACCTCTCACGAAGATTGCCCACGTCACCTACGA TTCGGTGCCCATTTCGCACACGCCCTACGAACATGTTCCTCTCTTCCAGA GGATTGGTCATGTCAAAAACATTAGGTTCTAGCGATGTATACCCTAGAAA AACATAGTTTAACTTATAAATAAAAACAAATAATAATAAAAAAAAAAAAA AAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 16270257..16270565 | 26..337 | 1415 | 98.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 16280549..16280862 | 26..339 | 1570 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
TAHRE | 10463 | TAHRE OSV 10463bp | 8450..8533 | 256..337 | 127 | 64.7 | Plus |
TAHRE | 10463 | TAHRE OSV 10463bp | 9363..9427 | 268..337 | 103 | 67.1 | Plus |
accord2 | 7650 | accord2 QBERT 7650bp | 6247..6281 | 332..298 | 103 | 77.1 | Minus |
transib2 | 2844 | transib2 TRANSIB2 2844bp | 46..119 | 258..336 | 103 | 64.6 | Plus |
HeT-A | 6083 | HeT-A DM06920 6083bp Derived from U06920.2 (Rel. 67, Last updated, Version 14). | 5187..5226 | 297..336 | 101 | 72.5 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 16270169..16270195 | 1..27 | 100 | -> | Plus |
chr3L | 16270259..16270542 | 28..315 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13064-RA | 1..264 | 19..282 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13064-RA | 1..264 | 19..282 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13064-RA | 1..264 | 19..282 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13064-RA | 1..264 | 19..282 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13064-RA | 58..372 | 1..315 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13064-RA | 58..372 | 1..315 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 16280461..16280487 | 1..27 | 100 | -> | Plus |
3L | 16280551..16280838 | 28..315 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 16280461..16280487 | 1..27 | 100 | -> | Plus |
3L | 16280551..16280838 | 28..315 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 16280461..16280487 | 1..27 | 100 | -> | Plus |
3L | 16280551..16280838 | 28..315 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 16273561..16273587 | 1..27 | 100 | -> | Plus |
arm_3L | 16273651..16273938 | 28..315 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 16273651..16273938 | 28..315 | 100 | Plus | |
3L | 16273561..16273587 | 1..27 | 100 | -> | Plus |
Translation from 0 to 281
> FI15201.hyp PQYHQRMFKLVVLFGLLSGAFAATVIYHHPVIYHHPLPVASTPQELAQHP GYTIVAPLTKIAHVTYDSVPISHTPYEHVPLFQRIGHVKNIRF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13064-PA | 87 | CG13064-PA | 1..87 | 7..93 | 465 | 100 | Plus |
Translation from 0 to 281
> FI15201.pep PQYHQRMFKLVVLFGLLSGAFAATVIYHHPVIYHHPLPVASTPQELAQHP GYTIVAPLTKIAHVTYDSVPISHTPYEHVPLFQRIGHVKNIRF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24174-PA | 82 | GF24174-PA | 1..82 | 13..93 | 350 | 85.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG15979-PA | 87 | GG15979-PA | 1..87 | 7..93 | 406 | 93.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH15870-PA | 94 | GH15870-PA | 5..94 | 7..93 | 258 | 62.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13064-PA | 87 | CG13064-PA | 1..87 | 7..93 | 465 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI12651-PA | 89 | GI12651-PA | 10..89 | 11..93 | 267 | 68.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL17846-PA | 94 | GL17846-PA | 3..87 | 7..92 | 252 | 66.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA28510-PA | 87 | GA28510-PA | 3..80 | 10..92 | 254 | 69.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25612-PA | 87 | GM25612-PA | 18..87 | 24..93 | 351 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14616-PA | 87 | GD14616-PA | 1..87 | 7..93 | 413 | 94.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ12772-PA | 93 | GJ12772-PA | 10..93 | 8..93 | 255 | 64.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK19251-PA | 87 | GK19251-PA | 7..87 | 20..93 | 265 | 70.4 | Plus |