Clone Sequence Records
FI15202.complete Sequence
379 bp assembled on 2011-09-15
GenBank Submission: BT128900.1
> FI15202.complete
AAGAAAACAATCACCACGAAAACTACTGAAAATGATGCAAATCAAGTTCC
TGTTCACCTTCCTCGCTCTGCTGATGATGGTCATCCTGGGCGCCAAGGAA
GCCGATGCCGACTGCCTTTCCGGAAGGTACAGAGGTCCCTGTGCCGTCTG
GGACAACGAGACATGCAGGCGGGTTTGCCGAGAGGAGGGACGAGGACGAG
TGAGTGGTCACTGCAGTGCCAGGCTGCAATGCTGGTGCGAAGGATGCTGA
ATTTCTACCGAAATTGGACAACTTCTATAGACCCAGAATGATTATGTATC
AATCATAAAATTCAATTCCCTAAACATTCACAATTATTTAAAATAAAATC
AAGTCAAGAACCAAAAAAAAAAAAAAAAA
FI15202.complete Blast Records
Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:01:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 3335472..3335833 | 362..1 | 1780 | 99.4 | Minus |
chr3L | 24539361 | chr3L | 3316241..3316448 | 35..248 | 420 | 80.8 | Plus |
chr3L | 24539361 | chr3L | 3369043..3369257 | 32..252 | 410 | 80.1 | Plus |
chr3L | 24539361 | chr3L | 3313782..3313997 | 31..252 | 325 | 77.5 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:01:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 3336030..3336393 | 364..1 | 1820 | 100 | Minus |
3L | 28110227 | 3L | 3316835..3317042 | 35..248 | 420 | 80.8 | Plus |
3L | 28110227 | 3L | 3369619..3369833 | 32..252 | 410 | 80.1 | Plus |
3L | 28110227 | 3L | 3314374..3314589 | 31..252 | 310 | 77 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:01:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 3336030..3336393 | 364..1 | 1820 | 100 | Minus |
3L | 28103327 | 3L | 3369619..3369779 | 32..192 | 400 | 83.2 | Plus |
3L | 28103327 | 3L | 3316835..3316993 | 35..193 | 390 | 83 | Plus |
3L | 28103327 | 3L | 3314374..3314534 | 31..191 | 265 | 77.6 | Plus |
3L | 28103327 | 3L | 3314540..3314589 | 203..252 | 175 | 90 | Plus |
3L | 28103327 | 3L | 3315795..3315852 | 193..250 | 170 | 86.2 | Plus |
3L | 28103327 | 3L | 3335668..3335718 | 155..105 | 150 | 86.2 | Minus |
3L | 28103327 | 3L | 3369784..3369833 | 203..252 | 145 | 86 | Plus |
3L | 28103327 | 3L | 3316987..3317042 | 193..248 | 145 | 83.9 | Plus |
3L | 28103327 | 3L | 3335581..3335626 | 248..203 | 140 | 86.9 | Minus |
Blast to na_te.dros performed 2019-03-15 11:01:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\Ulysses | 10653 | Dvir\Ulysses DVULYSS 10653bp AKA(S37633) Derived from X56645 (Rel. 38, Last updated, Version 6). | 3437..3485 | 207..255 | 119 | 71.4 | Plus |
FI15202.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:02:28 Download gff for
FI15202.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 3335472..3335833 | 1..362 | 99 | | Minus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-09-15 09:50:09 Download gff for
FI15202.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
dro6-RA | 1..219 | 32..250 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:33:37 Download gff for
FI15202.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Drsl6-RA | 1..219 | 32..250 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:19:49 Download gff for
FI15202.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Drsl6-RA | 1..219 | 32..250 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-15 09:50:09 Download gff for
FI15202.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
dro6-RA | 26..387 | 1..362 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:33:37 Download gff for
FI15202.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Drsl6-RA | 26..387 | 1..362 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:19:49 Download gff for
FI15202.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Drsl6-RA | 26..387 | 1..362 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:02:28 Download gff for
FI15202.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3336032..3336393 | 1..362 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:02:28 Download gff for
FI15202.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3336032..3336393 | 1..362 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:02:28 Download gff for
FI15202.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3336032..3336393 | 1..362 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:33:37 Download gff for
FI15202.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 3336032..3336393 | 1..362 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:48:29 Download gff for
FI15202.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3336032..3336393 | 1..362 | 100 | | Minus |
FI15202.hyp Sequence
Translation from 0 to 290
> FI15202.hyp
KKTITTKTTENDANQVPVHLPRSADDGHPGRQGSRCRLPFRKVQRSLCRL
GQRDMQAGLPRGGTRTSEWSLQCQAAMLVRRMLNFYRNWTTSIDPE*
Sequence FI15202.hyp has no blast hits.
FI15202.pep Sequence
Translation from 1 to 249
> FI15202.pep
RKQSPRKLLKMMQIKFLFTFLALLMMVILGAKEADADCLSGRYRGPCAVW
DNETCRRVCREEGRGRVSGHCSARLQCWCEGC*
FI15202.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:34:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF24279-PA | 69 | GF24279-PA | 1..69 | 12..82 | 300 | 80.3 | Plus |
Dana\GF10208-PA | 69 | GF10208-PA | 1..69 | 12..82 | 297 | 78.9 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:34:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG14261-PA | 72 | GG14261-PA | 1..72 | 11..82 | 345 | 87.5 | Plus |
Dere\GG15135-PA | 70 | GG15135-PA | 1..70 | 11..82 | 303 | 76.4 | Plus |
Dere\GG15129-PA | 69 | GG15129-PA | 1..69 | 12..82 | 293 | 77.5 | Plus |
Dere\GG15126-PA | 70 | GG15126-PA | 1..70 | 11..82 | 266 | 65.3 | Plus |
Dere\GG15127-PA | 71 | GG15127-PA | 1..71 | 11..82 | 236 | 64.4 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:56:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Drsl6-PA | 72 | CG32268-PA | 1..72 | 11..82 | 403 | 100 | Plus |
Drs-PA | 70 | CG10810-PA | 1..70 | 11..82 | 324 | 77.8 | Plus |
Drsl5-PA | 69 | CG10812-PA | 1..69 | 12..82 | 316 | 78.9 | Plus |
Drsl2-PA | 70 | CG32279-PA | 1..70 | 11..82 | 299 | 69.4 | Plus |
Drsl1-PA | 69 | CG32274-PA | 1..69 | 12..82 | 247 | 60.6 | Plus |
Drsl4-PA | 71 | CG32282-PA | 1..71 | 11..82 | 235 | 61.6 | Plus |
Drsl3-PA | 71 | CG32283-PA | 1..71 | 11..82 | 211 | 53.4 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:34:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM14569-PA | 72 | GM14569-PA | 1..70 | 11..82 | 302 | 76.4 | Plus |
Dsec\GM14054-PA | 72 | GM14054-PA | 1..72 | 11..82 | 297 | 95.8 | Plus |
Dsec\GM14562-PA | 69 | GM14562-PA | 1..69 | 12..82 | 286 | 76.1 | Plus |
Dsec\GM14560-PA | 70 | GM14560-PA | 1..70 | 11..82 | 285 | 69.4 | Plus |
Dsec\GM14055-PA | 69 | GM14055-PA | 1..69 | 12..82 | 239 | 63.4 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:34:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\Drs-PA | 70 | GD13760-PA | 1..70 | 11..82 | 307 | 77.8 | Plus |
Dsim\dro5-PA | 69 | GD13754-PA | 1..69 | 12..82 | 297 | 78.9 | Plus |
Dsim\dro6-PA | 72 | GD13330-PA | 1..72 | 11..82 | 297 | 95.8 | Plus |
Dsim\dro1-PA | 69 | GD13331-PA | 1..69 | 12..82 | 240 | 63.4 | Plus |
Dsim\dro4-PA | 71 | GD13753-PA | 1..71 | 11..82 | 220 | 61.6 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:34:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE20688-PA | 72 | GE20688-PA | 1..72 | 11..82 | 364 | 93.1 | Plus |
Dyak\GE21361-PA | 70 | GE21361-PA | 1..70 | 11..82 | 307 | 77.8 | Plus |
Dyak\GE21355-PA | 69 | GE21355-PA | 1..69 | 12..82 | 292 | 77.5 | Plus |
Dyak\GE21352-PA | 70 | GE21352-PA | 1..70 | 11..82 | 263 | 63.9 | Plus |
Dyak\GE20689-PA | 69 | GE20689-PA | 1..69 | 12..82 | 231 | 60.6 | Plus |