Clone FI15202 Report

Search the DGRC for FI15202

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:152
Well:2
Vector:pOT2
Associated Gene/TranscriptDrsl6-RA
Protein status:FI15202.pep: gold
Sequenced Size:379

Clone Sequence Records

FI15202.complete Sequence

379 bp assembled on 2011-09-15

GenBank Submission: BT128900.1

> FI15202.complete
AAGAAAACAATCACCACGAAAACTACTGAAAATGATGCAAATCAAGTTCC
TGTTCACCTTCCTCGCTCTGCTGATGATGGTCATCCTGGGCGCCAAGGAA
GCCGATGCCGACTGCCTTTCCGGAAGGTACAGAGGTCCCTGTGCCGTCTG
GGACAACGAGACATGCAGGCGGGTTTGCCGAGAGGAGGGACGAGGACGAG
TGAGTGGTCACTGCAGTGCCAGGCTGCAATGCTGGTGCGAAGGATGCTGA
ATTTCTACCGAAATTGGACAACTTCTATAGACCCAGAATGATTATGTATC
AATCATAAAATTCAATTCCCTAAACATTCACAATTATTTAAAATAAAATC
AAGTCAAGAACCAAAAAAAAAAAAAAAAA

FI15202.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:01:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 3335472..3335833 362..1 1780 99.4 Minus
chr3L 24539361 chr3L 3316241..3316448 35..248 420 80.8 Plus
chr3L 24539361 chr3L 3369043..3369257 32..252 410 80.1 Plus
chr3L 24539361 chr3L 3313782..3313997 31..252 325 77.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:01:26
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3336030..3336393 364..1 1820 100 Minus
3L 28110227 3L 3316835..3317042 35..248 420 80.8 Plus
3L 28110227 3L 3369619..3369833 32..252 410 80.1 Plus
3L 28110227 3L 3314374..3314589 31..252 310 77 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:01:40
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 3336030..3336393 364..1 1820 100 Minus
3L 28103327 3L 3369619..3369779 32..192 400 83.2 Plus
3L 28103327 3L 3316835..3316993 35..193 390 83 Plus
3L 28103327 3L 3314374..3314534 31..191 265 77.6 Plus
3L 28103327 3L 3314540..3314589 203..252 175 90 Plus
3L 28103327 3L 3315795..3315852 193..250 170 86.2 Plus
3L 28103327 3L 3335668..3335718 155..105 150 86.2 Minus
3L 28103327 3L 3369784..3369833 203..252 145 86 Plus
3L 28103327 3L 3316987..3317042 193..248 145 83.9 Plus
3L 28103327 3L 3335581..3335626 248..203 140 86.9 Minus
Blast to na_te.dros performed 2019-03-15 11:01:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Ulysses 10653 Dvir\Ulysses DVULYSS 10653bp AKA(S37633) Derived from X56645 (Rel. 38, Last updated, Version 6). 3437..3485 207..255 119 71.4 Plus

FI15202.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:02:28 Download gff for FI15202.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 3335472..3335833 1..362 99   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-09-15 09:50:09 Download gff for FI15202.complete
Subject Subject Range Query Range Percent Splice Strand
dro6-RA 1..219 32..250 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:33:37 Download gff for FI15202.complete
Subject Subject Range Query Range Percent Splice Strand
Drsl6-RA 1..219 32..250 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:19:49 Download gff for FI15202.complete
Subject Subject Range Query Range Percent Splice Strand
Drsl6-RA 1..219 32..250 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-15 09:50:09 Download gff for FI15202.complete
Subject Subject Range Query Range Percent Splice Strand
dro6-RA 26..387 1..362 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:33:37 Download gff for FI15202.complete
Subject Subject Range Query Range Percent Splice Strand
Drsl6-RA 26..387 1..362 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:19:49 Download gff for FI15202.complete
Subject Subject Range Query Range Percent Splice Strand
Drsl6-RA 26..387 1..362 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:02:28 Download gff for FI15202.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3336032..3336393 1..362 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:02:28 Download gff for FI15202.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3336032..3336393 1..362 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:02:28 Download gff for FI15202.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3336032..3336393 1..362 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:33:37 Download gff for FI15202.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3336032..3336393 1..362 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:48:29 Download gff for FI15202.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3336032..3336393 1..362 100   Minus

FI15202.hyp Sequence

Translation from 0 to 290

> FI15202.hyp
KKTITTKTTENDANQVPVHLPRSADDGHPGRQGSRCRLPFRKVQRSLCRL
GQRDMQAGLPRGGTRTSEWSLQCQAAMLVRRMLNFYRNWTTSIDPE*
Sequence FI15202.hyp has no blast hits.

FI15202.pep Sequence

Translation from 1 to 249

> FI15202.pep
RKQSPRKLLKMMQIKFLFTFLALLMMVILGAKEADADCLSGRYRGPCAVW
DNETCRRVCREEGRGRVSGHCSARLQCWCEGC*

FI15202.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:34:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24279-PA 69 GF24279-PA 1..69 12..82 300 80.3 Plus
Dana\GF10208-PA 69 GF10208-PA 1..69 12..82 297 78.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:34:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14261-PA 72 GG14261-PA 1..72 11..82 345 87.5 Plus
Dere\GG15135-PA 70 GG15135-PA 1..70 11..82 303 76.4 Plus
Dere\GG15129-PA 69 GG15129-PA 1..69 12..82 293 77.5 Plus
Dere\GG15126-PA 70 GG15126-PA 1..70 11..82 266 65.3 Plus
Dere\GG15127-PA 71 GG15127-PA 1..71 11..82 236 64.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:56:41
Subject Length Description Subject Range Query Range Score Percent Strand
Drsl6-PA 72 CG32268-PA 1..72 11..82 403 100 Plus
Drs-PA 70 CG10810-PA 1..70 11..82 324 77.8 Plus
Drsl5-PA 69 CG10812-PA 1..69 12..82 316 78.9 Plus
Drsl2-PA 70 CG32279-PA 1..70 11..82 299 69.4 Plus
Drsl1-PA 69 CG32274-PA 1..69 12..82 247 60.6 Plus
Drsl4-PA 71 CG32282-PA 1..71 11..82 235 61.6 Plus
Drsl3-PA 71 CG32283-PA 1..71 11..82 211 53.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:34:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14569-PA 72 GM14569-PA 1..70 11..82 302 76.4 Plus
Dsec\GM14054-PA 72 GM14054-PA 1..72 11..82 297 95.8 Plus
Dsec\GM14562-PA 69 GM14562-PA 1..69 12..82 286 76.1 Plus
Dsec\GM14560-PA 70 GM14560-PA 1..70 11..82 285 69.4 Plus
Dsec\GM14055-PA 69 GM14055-PA 1..69 12..82 239 63.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:34:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Drs-PA 70 GD13760-PA 1..70 11..82 307 77.8 Plus
Dsim\dro5-PA 69 GD13754-PA 1..69 12..82 297 78.9 Plus
Dsim\dro6-PA 72 GD13330-PA 1..72 11..82 297 95.8 Plus
Dsim\dro1-PA 69 GD13331-PA 1..69 12..82 240 63.4 Plus
Dsim\dro4-PA 71 GD13753-PA 1..71 11..82 220 61.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:34:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20688-PA 72 GE20688-PA 1..72 11..82 364 93.1 Plus
Dyak\GE21361-PA 70 GE21361-PA 1..70 11..82 307 77.8 Plus
Dyak\GE21355-PA 69 GE21355-PA 1..69 12..82 292 77.5 Plus
Dyak\GE21352-PA 70 GE21352-PA 1..70 11..82 263 63.9 Plus
Dyak\GE20689-PA 69 GE20689-PA 1..69 12..82 231 60.6 Plus