Clone FI15222 Report

Search the DGRC for FI15222

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:152
Well:22
Vector:pOT2
Associated Gene/TranscriptCG42823-RA
Protein status:FI15222.pep: gold
Sequenced Size:562

Clone Sequence Records

FI15222.complete Sequence

562 bp assembled on 2011-08-23

GenBank Submission: BT128834.1

> FI15222.complete
GCTCATCATGCCCAACGTGATCGTCAACCTGTCATTAATTTTCTTATTCT
TGGGTGGTATTTTCCATCTCAATGAAGCCCAGACAACGGATTGTTCGAAT
TCGTGTATTTTTCGAGCAAGATGCACTCCCTACTACAAGGATTTGGTCTG
GTCAGTGGTGGACCGCGTTTGTCGGGTCTTTCAAAACGGTTGCATCTTTG
CCAATGAAAATTGCATGAGAGCCAATCGCTGCTTGCCACCCATGGTAGCC
ACCACAAAGGAAGAGTGTACGAAGGAGATCTACTGTCCAAGGTGGTGTTC
CCGAGGAGCTCCGCCGGTCTGCGCATGGTTTCCCTATACAGACAGTAATG
GGAATACCGGAGGTCGAGACATGTCATTCGGAAGTCGCTGTCTACTAGAC
ATGTATGCCTGCCGTAATGAACAGGCCTATGTCAACGAACCACGTATAGG
ATCGTGCACATAAAATGTTAAAATAAATAATAAAACATTTTCCAATAAAT
TCAAGCTAAATAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAA

FI15222.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 10:57:53
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 13229234..13229472 239..1 1150 98.7 Minus
chr3R 27901430 chr3R 13228990..13229175 425..240 915 99.5 Minus
chr3R 27901430 chr3R 13228847..13228933 511..425 435 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 10:57:51
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17404874..17405112 239..1 1195 100 Minus
3R 32079331 3R 17404630..17404815 425..240 930 100 Minus
3R 32079331 3R 17404485..17404573 513..425 445 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:01:06
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 17145705..17145943 239..1 1195 100 Minus
3R 31820162 3R 17145461..17145646 425..240 930 100 Minus
3R 31820162 3R 17145316..17145404 513..425 445 100 Minus
Blast to na_te.dros performed on 2019-03-15 10:57:52 has no hits.

FI15222.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 10:58:54 Download gff for FI15222.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 13228847..13228932 426..511 100 <- Minus
chr3R 13228990..13229175 240..425 99 <- Minus
chr3R 13229234..13229472 1..239 98   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-08-23 14:27:28 Download gff for FI15222.complete
Subject Subject Range Query Range Percent Splice Strand
CG42823-RA 1..456 8..463 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:30:50 Download gff for FI15222.complete
Subject Subject Range Query Range Percent Splice Strand
CG42823-RA 1..456 8..463 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:17:13 Download gff for FI15222.complete
Subject Subject Range Query Range Percent Splice Strand
CG42823-RA 1..456 8..463 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-23 14:27:27 Download gff for FI15222.complete
Subject Subject Range Query Range Percent Splice Strand
CG42823-RA 1..508 4..511 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:30:50 Download gff for FI15222.complete
Subject Subject Range Query Range Percent Splice Strand
CG42823-RA 1..508 4..511 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:17:13 Download gff for FI15222.complete
Subject Subject Range Query Range Percent Splice Strand
CG42823-RA 1..508 4..511 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:58:54 Download gff for FI15222.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17404874..17405112 1..239 100   Minus
3R 17404487..17404572 426..511 100 <- Minus
3R 17404630..17404815 240..425 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:58:54 Download gff for FI15222.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17404874..17405112 1..239 100   Minus
3R 17404487..17404572 426..511 100 <- Minus
3R 17404630..17404815 240..425 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:58:54 Download gff for FI15222.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17404874..17405112 1..239 100   Minus
3R 17404487..17404572 426..511 100 <- Minus
3R 17404630..17404815 240..425 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:30:50 Download gff for FI15222.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13230209..13230294 426..511 100 <- Minus
arm_3R 13230352..13230537 240..425 100 <- Minus
arm_3R 13230596..13230834 1..239 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:47:24 Download gff for FI15222.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17145705..17145943 1..239 100   Minus
3R 17145318..17145403 426..511 100 <- Minus
3R 17145461..17145646 240..425 100 <- Minus

FI15222.hyp Sequence

Translation from 0 to 462

> FI15222.hyp
LIMPNVIVNLSLIFLFLGGIFHLNEAQTTDCSNSCIFRARCTPYYKDLVW
SVVDRVCRVFQNGCIFANENCMRANRCLPPMVATTKEECTKEIYCPRWCS
RGAPPVCAWFPYTDSNGNTGGRDMSFGSRCLLDMYACRNEQAYVNEPRIG
SCT*

FI15222.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:56:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG42823-PA 151 CG42823-PA 1..151 3..153 853 100 Plus
CG7695-PA 145 CG7695-PA 7..131 8..143 146 28.7 Plus
CG7587-PA 142 CG7587-PA 32..138 40..145 145 33.6 Plus

FI15222.pep Sequence

Translation from 1 to 462

> FI15222.pep
LIMPNVIVNLSLIFLFLGGIFHLNEAQTTDCSNSCIFRARCTPYYKDLVW
SVVDRVCRVFQNGCIFANENCMRANRCLPPMVATTKEECTKEIYCPRWCS
RGAPPVCAWFPYTDSNGNTGGRDMSFGSRCLLDMYACRNEQAYVNEPRIG
SCT*

FI15222.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:28:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18614-PA 144 GF18614-PA 4..143 11..152 537 66.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:28:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16775-PA 145 GG16775-PA 8..145 16..153 652 86.2 Plus
Dere\GG22329-PA 142 GG22329-PA 32..138 40..145 150 34.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 19:28:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17493-PA 176 GH17493-PA 28..138 27..139 272 45.1 Plus
Dgri\GH13510-PA 293 GH13510-PA 108..208 18..145 142 32 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:23:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG42823-PA 151 CG42823-PA 1..151 3..153 853 100 Plus
CG7695-PA 145 CG7695-PA 7..131 8..143 146 28.7 Plus
CG7587-PA 142 CG7587-PA 32..138 40..145 145 33.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 19:28:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22824-PA 471 GI22824-PA 1..131 7..139 246 39.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:28:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23939-PA 148 GL23939-PA 2..147 5..152 469 58.8 Plus
Dper\GL23937-PA 146 GL23937-PA 20..145 24..152 347 51.2 Plus
Dper\GL23938-PA 115 GL23938-PA 17..107 7..99 272 54.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:28:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27116-PA 148 GA27116-PA 2..147 5..152 465 58.1 Plus
Dpse\GA27114-PA 149 GA27114-PA 3..142 7..152 435 55.5 Plus
Dpse\GA30067-PA 147 GA30067-PA 3..146 7..152 428 54.8 Plus
Dpse\GA27115-PA 147 GA27115-PA 22..146 26..152 362 54.3 Plus
Dpse\GA20459-PA 144 GA20459-PA 33..138 41..145 138 31.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:28:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15365-PA 151 GM15365-PA 1..151 3..153 753 92.1 Plus
Dsec\GM15244-PA 142 GM15244-PA 32..138 40..145 139 33.6 Plus
Dsec\GM18695-PA 145 GM18695-PA 7..131 8..143 136 28.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:28:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20234-PA 151 GD20234-PA 1..151 3..153 773 94.7 Plus
Dsim\GD19169-PA 142 GD19169-PA 32..138 40..145 139 33.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:28:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22824-PA 146 GJ22824-PA 1..144 7..152 358 48.6 Plus
Dvir\GJ24445-PA 143 GJ24445-PA 4..135 12..145 170 36.2 Plus
Dvir\GJ24431-PA 113 GJ24431-PA 9..113 14..145 138 30.3 Plus
Dvir\GJ24433-PA 150 GJ24433-PA 6..134 3..143 138 28 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 19:28:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11453-PA 149 GK11453-PA 10..148 12..152 365 49.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:28:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24167-PA 148 GE24167-PA 1..148 6..153 728 89.9 Plus
Dyak\GE25480-PA 142 GE25480-PA 32..141 40..148 162 37.2 Plus