Clone FI15224 Report

Search the DGRC for FI15224

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:152
Well:24
Vector:pOT2
Associated Gene/TranscriptPeritrophin-15a-RA
Protein status:FI15224.pep: gold
Sequenced Size:340

Clone Sequence Records

FI15224.complete Sequence

340 bp assembled on 2011-08-23

GenBank Submission: BT128837.1

> FI15224.complete
CTCAATTGCACCATGAAGTCCGCACTACTTTTGATCTGCCTTGCCTTCTT
CGTGGCGCTCCTAAGCACCGGAAATGCGTGCGATCCCAATTCTGACAACC
AGCCCGACTGCAGCGACGCATCCAACGTGCAAACGAACATCCGCAACTTC
TGGGATCCCACTCGCTACTGGTGGTGTGAGTCCTCCACCTCCACGGCCAC
GGCTGTGTTGTGCCCGTTGTCCACTGGATTCGACCCCACAAAGAAGGAGT
GCGTTTCATGGAGCGAATGGTCTTGGACTGCTTACTGTTGATTGCATTTT
TAATAACAACTTTAATGAAAATATATGGCAAACTAAATGA

FI15224.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 10:57:45
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 8394575..8394892 339..22 1545 99.1 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 10:57:42
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8395664..8395982 340..22 1550 99.1 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:01:02
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8395664..8395982 340..22 1550 99 Minus
Blast to na_te.dros performed on 2019-03-15 10:57:43 has no hits.

FI15224.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 10:58:50 Download gff for FI15224.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 8394575..8394891 23..339 99 <- Minus
chr2L 8394963..8394984 1..22 100   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-08-23 10:47:50 Download gff for FI15224.complete
Subject Subject Range Query Range Percent Splice Strand
Peritrophin-15a-RA 1..279 13..291 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:30:40 Download gff for FI15224.complete
Subject Subject Range Query Range Percent Splice Strand
Peritrophin-15a-RA 1..279 13..291 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:17:03 Download gff for FI15224.complete
Subject Subject Range Query Range Percent Splice Strand
Peritrophin-15a-RA 1..279 13..291 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-23 10:47:50 Download gff for FI15224.complete
Subject Subject Range Query Range Percent Splice Strand
Peritrophin-15a-RA 11..349 1..339 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:30:40 Download gff for FI15224.complete
Subject Subject Range Query Range Percent Splice Strand
Peritrophin-15a-RA 23..361 1..339 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:17:03 Download gff for FI15224.complete
Subject Subject Range Query Range Percent Splice Strand
Peritrophin-15a-RA 23..361 1..339 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:58:50 Download gff for FI15224.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8395665..8395981 23..339 99 <- Minus
2L 8396053..8396074 1..22 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:58:50 Download gff for FI15224.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8395665..8395981 23..339 99 <- Minus
2L 8396053..8396074 1..22 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:58:50 Download gff for FI15224.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8395665..8395981 23..339 99 <- Minus
2L 8396053..8396074 1..22 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:30:40 Download gff for FI15224.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8395665..8395981 23..339 99 <- Minus
arm_2L 8396053..8396074 1..22 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:47:16 Download gff for FI15224.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8395665..8395981 23..339 99 <- Minus
2L 8396053..8396074 1..22 100   Minus

FI15224.hyp Sequence

Translation from 0 to 290

> FI15224.hyp
LNCTMKSALLLICLAFFVALLSTGNACDPNSDNQPDCSDASNVQTNIRNF
WDPTRYWWCESSTSTATAVLCPLSTGFDPTKKECVSWSEWSWTAYC*

FI15224.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:53:01
Subject Length Description Subject Range Query Range Score Percent Strand
Peritrophin-15a-PA 92 CG17814-PA 1..92 5..96 522 100 Plus
Peritrophin-15b-PC 93 CG31893-PC 1..88 5..96 201 44.6 Plus
Peritrophin-15b-PA 93 CG31893-PA 1..88 5..96 201 44.6 Plus
Peritrophin-15b-PB 91 CG31893-PB 1..86 5..96 190 42.6 Plus
CG14645-PA 97 CG14645-PA 12..85 20..92 161 39.2 Plus

FI15224.pep Sequence

Translation from 0 to 290

> FI15224.pep
LNCTMKSALLLICLAFFVALLSTGNACDPNSDNQPDCSDASNVQTNIRNF
WDPTRYWWCESSTSTATAVLCPLSTGFDPTKKECVSWSEWSWTAYC*

FI15224.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:28:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14680-PA 91 GF14680-PA 1..88 5..96 244 52.2 Plus
Dana\GF18205-PA 97 GF18205-PA 10..87 18..94 149 38.5 Plus
Dana\GF16020-PA 95 GF16020-PA 20..85 30..94 141 40.9 Plus
Dana\GF16454-PA 79 GF16454-PA 7..68 32..93 134 37.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:28:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23443-PA 98 GG23443-PA 1..97 5..96 357 69.1 Plus
Dere\GG12307-PA 99 GG12307-PA 1..85 5..92 151 38.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 19:28:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11353-PA 116 GH11353-PA 28..113 5..96 192 39.1 Plus
Dgri\GH23637-PA 173 GH23637-PA 87..170 7..96 181 37.8 Plus
Dgri\GH18866-PA 98 GH18866-PA 5..85 10..92 153 42.9 Plus
Dgri\GH23637-PA 173 GH23637-PA 28..87 5..68 138 40.6 Plus
Dgri\GH18629-PA 94 GH18629-PA 9..88 11..92 135 32.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:39:50
Subject Length Description Subject Range Query Range Score Percent Strand
Peritrophin-15a-PA 92 CG17814-PA 1..92 5..96 522 100 Plus
Peritrophin-15b-PC 93 CG31893-PC 1..88 5..96 201 44.6 Plus
Peritrophin-15b-PA 93 CG31893-PA 1..88 5..96 201 44.6 Plus
Peritrophin-15b-PB 91 CG31893-PB 1..86 5..96 190 42.6 Plus
CG14645-PA 97 CG14645-PA 12..85 20..92 161 39.2 Plus
CG3348-PB 98 CG3348-PB 19..80 32..93 137 33.9 Plus
CG3348-PA 98 CG3348-PA 19..80 32..93 137 33.9 Plus
CG14244-PB 106 CG14244-PB 10..90 10..92 136 34.9 Plus
CG34282-PB 94 CG34282-PB 5..88 7..92 134 31.4 Plus
CG34282-PA 94 CG34282-PA 5..88 7..92 134 31.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 19:28:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12955-PA 90 GI12955-PA 13..86 16..96 173 45.7 Plus
Dmoj\GI24723-PA 97 GI24723-PA 5..85 10..92 145 40.5 Plus
Dmoj\GI24570-PA 89 GI24570-PA 15..78 30..93 132 35.9 Plus
Dmoj\GI10808-PA 131 GI10808-PA 42..125 7..92 131 31.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:28:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25804-PA 90 GL25804-PA 1..89 5..96 211 45.7 Plus
Dper\GL25805-PA 89 GL25805-PA 1..88 5..96 205 46.7 Plus
Dper\GL18453-PA 89 GL18453-PA 1..88 5..96 205 46.7 Plus
Dper\GL12319-PA 97 GL12319-PA 22..87 30..94 141 42.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:28:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25453-PA 90 GA25453-PA 1..89 5..96 215 47.8 Plus
Dpse\GA16549-PA 89 GA16549-PA 1..88 5..96 205 46.7 Plus
Dpse\GA13143-PA 97 GA13143-PA 22..87 30..94 141 42.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:28:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12960-PA 92 GM12960-PA 1..92 5..96 414 85.9 Plus
Dsec\GM12961-PA 93 GM12961-PA 1..88 5..96 177 44.6 Plus
Dsec\GM10746-PA 97 GM10746-PA 1..85 5..92 143 38.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:28:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22405-PA 92 GD22405-PA 1..92 5..96 422 87 Plus
Dsim\GD22406-PA 93 GD22406-PA 1..88 5..96 183 44.6 Plus
Dsim\GD19718-PA 97 GD19718-PA 1..85 5..92 148 39.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:28:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18192-PA 90 GJ18192-PA 1..87 5..96 228 53.3 Plus
Dvir\GJ14550-PA 97 GJ14550-PA 5..85 10..92 146 42.9 Plus
Dvir\GJ22636-PA 89 GJ22636-PA 15..78 30..93 130 35.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 19:28:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11657-PA 99 GK11657-PA 3..86 10..92 136 32.1 Plus
Dwil\GK11341-PA 97 GK11341-PA 19..84 30..95 129 33.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:28:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11001-PA 97 GE11001-PA 1..96 5..96 343 67.7 Plus
Dyak\GE11009-PA 93 GE11009-PA 1..88 5..96 199 48.9 Plus
Dyak\GE25408-PA 97 GE25408-PA 1..85 5..92 143 38.2 Plus