Clone FI15228 Report

Search the DGRC for FI15228

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:152
Well:28
Vector:pOT2
Associated Gene/Transcriptkarr-RA
Protein status:FI15228.pep: gold
Sequenced Size:468

Clone Sequence Records

FI15228.complete Sequence

468 bp assembled on 2011-08-23

GenBank Submission: BT128836.1

> FI15228.complete
ACACGTGAACATGAAGTTTCGTTGCGACTGAAAATAAAGTTCACTTTCGT
CTCACCAATTGCCTAGGAAACAATATCCAGAGCTCAACTGAATTTAGAAA
TGGCAGAGAAGTCGAACGCGGATGCGAAGGCATCTAAAAACAACAAGTAC
ATGACGAGCGAGGATCCTGAGCAGCCAAGTGAATCGTCCACCCAGAAGGA
GAAGGGTTCGCAGTCTTCAGAGTCCGAGGAAGAATACTTTAAGAATGTGT
CCGAGCGCTTCGATAAGGACATAAAGGACCTGAAAGATCTGATTGCCCTG
AATGAGAAGGAATGTAATAGGCTGTTATTCGATCGCCTCCTGGATGTAAT
CAGAGTGGAAATAGAAGAAAAGCTACATTTGCCGAAGAAATAGTATATTA
ACCTATTCCCAAAATACCAATGTATTATCATGTATGGTCTTGACGCATAA
ATAAAATAATAACAATAA

FI15228.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 10:57:56
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 19998681..19999146 466..1 2315 99.8 Minus
chrX 22417052 chrX 20029580..20029756 10..186 345 79.7 Plus
chrX 22417052 chrX 20028394..20028504 76..186 285 83.8 Plus
chrX 22417052 chrX 20393049..20393197 38..186 265 78.5 Plus
chrX 22417052 chrX 20439680..20439828 38..186 265 78.5 Plus
chrX 22417052 chrX 20124781..20124929 38..186 220 76.5 Plus
chrX 22417052 chrX 20311877..20311972 91..186 195 80.2 Plus
chrX 22417052 chrX 19984941..19985019 186..108 185 82.3 Minus
chr3L 24539361 chr3L 18285392..18285439 123..76 180 91.7 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 10:57:54
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 20110108..20110575 468..1 2340 100 Minus
X 23542271 X 20141016..20141192 10..186 345 79.7 Plus
X 23542271 X 20139829..20139939 76..186 285 83.8 Plus
X 23542271 X 20574262..20574410 38..186 265 78.5 Plus
X 23542271 X 20527603..20527751 38..186 250 77.9 Plus
X 23542271 X 20259255..20259403 38..186 220 76.5 Plus
X 23542271 X 20446394..20446489 91..186 195 80.2 Plus
X 23542271 X 20096394..20096472 186..108 185 82.3 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:01:06
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 20118206..20118673 468..1 2340 100 Minus
X 23527363 X 20147891..20148037 39..186 295 81 Plus
X 23527363 X 20149188..20149290 84..186 275 84.4 Plus
X 23527363 X 20559354..20559502 38..186 265 78.5 Plus
X 23527363 X 20512695..20512843 38..186 250 77.8 Plus
X 23527363 X 20431486..20431581 91..186 195 80.2 Plus
X 23527363 X 20244346..20244428 38..120 190 81.9 Plus
X 23527363 X 20104492..20104570 186..108 185 82.2 Minus
Blast to na_te.dros performed on 2019-03-15 10:57:55 has no hits.

FI15228.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 10:58:56 Download gff for FI15228.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 19998699..19999146 1..448 99   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-08-23 14:33:12 Download gff for FI15228.complete
Subject Subject Range Query Range Percent Splice Strand
CG15323-RA 1..294 100..393 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:30:54 Download gff for FI15228.complete
Subject Subject Range Query Range Percent Splice Strand
CG15323-RA 1..294 100..393 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:17:17 Download gff for FI15228.complete
Subject Subject Range Query Range Percent Splice Strand
karr-RA 1..294 100..393 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-23 14:33:11 Download gff for FI15228.complete
Subject Subject Range Query Range Percent Splice Strand
CG15323-RA 1..448 1..448 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:30:54 Download gff for FI15228.complete
Subject Subject Range Query Range Percent Splice Strand
CG15323-RA 1..448 1..448 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:17:17 Download gff for FI15228.complete
Subject Subject Range Query Range Percent Splice Strand
karr-RA 1..448 1..448 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:58:56 Download gff for FI15228.complete
Subject Subject Range Query Range Percent Splice Strand
X 20110128..20110575 1..448 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:58:56 Download gff for FI15228.complete
Subject Subject Range Query Range Percent Splice Strand
X 20110128..20110575 1..448 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:58:56 Download gff for FI15228.complete
Subject Subject Range Query Range Percent Splice Strand
X 20110128..20110575 1..448 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:30:54 Download gff for FI15228.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 20004161..20004608 1..448 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:47:25 Download gff for FI15228.complete
Subject Subject Range Query Range Percent Splice Strand
X 20118226..20118673 1..448 100   Minus

FI15228.hyp Sequence

Translation from 99 to 392

> FI15228.hyp
MAEKSNADAKASKNNKYMTSEDPEQPSESSTQKEKGSQSSESEEEYFKNV
SERFDKDIKDLKDLIALNEKECNRLLFDRLLDVIRVEIEEKLHLPKK*

FI15228.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:56:31
Subject Length Description Subject Range Query Range Score Percent Strand
karr-PA 97 CG15323-PA 1..97 1..97 488 100 Plus
CG42578-PA 92 CG42578-PA 1..89 1..94 171 43.6 Plus
CG34332-PA 87 CG34332-PA 1..84 1..94 158 40.4 Plus
CG42577-PA 92 CG42577-PA 1..89 1..94 148 40.4 Plus
CG42581-PA 85 CG42581-PA 2..82 4..94 142 38.5 Plus

FI15228.pep Sequence

Translation from 99 to 392

> FI15228.pep
MAEKSNADAKASKNNKYMTSEDPEQPSESSTQKEKGSQSSESEEEYFKNV
SERFDKDIKDLKDLIALNEKECNRLLFDRLLDVIRVEIEEKLHLPKK*

FI15228.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:54:59
Subject Length Description Subject Range Query Range Score Percent Strand
karr-PA 97 CG15323-PA 1..97 1..97 488 100 Plus
CG42578-PA 92 CG42578-PA 1..89 1..94 171 43.6 Plus
CG34332-PA 87 CG34332-PA 1..84 1..94 158 40.4 Plus
CG42577-PA 92 CG42577-PA 1..89 1..94 148 40.4 Plus
CG42581-PA 85 CG42581-PA 2..82 4..94 142 38.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:28:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22694-PA 114 GM22694-PA 1..114 1..97 273 51.8 Plus
Dsec\GM13264-PA 114 GM13264-PA 1..114 1..97 273 51.8 Plus
Dsec\GM23010-PA 108 GM23010-PA 1..108 1..97 265 52.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:28:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24880-PA 120 GD24880-PA 1..120 1..97 266 49.2 Plus
Dsim\GD15554-PA 144 GD15554-PA 70..144 21..97 241 66.2 Plus
Dsim\GD17479-PA 144 GD17479-PA 70..144 21..97 241 66.2 Plus