FI15228.complete Sequence
468 bp assembled on 2011-08-23
GenBank Submission: BT128836.1
> FI15228.complete
ACACGTGAACATGAAGTTTCGTTGCGACTGAAAATAAAGTTCACTTTCGT
CTCACCAATTGCCTAGGAAACAATATCCAGAGCTCAACTGAATTTAGAAA
TGGCAGAGAAGTCGAACGCGGATGCGAAGGCATCTAAAAACAACAAGTAC
ATGACGAGCGAGGATCCTGAGCAGCCAAGTGAATCGTCCACCCAGAAGGA
GAAGGGTTCGCAGTCTTCAGAGTCCGAGGAAGAATACTTTAAGAATGTGT
CCGAGCGCTTCGATAAGGACATAAAGGACCTGAAAGATCTGATTGCCCTG
AATGAGAAGGAATGTAATAGGCTGTTATTCGATCGCCTCCTGGATGTAAT
CAGAGTGGAAATAGAAGAAAAGCTACATTTGCCGAAGAAATAGTATATTA
ACCTATTCCCAAAATACCAATGTATTATCATGTATGGTCTTGACGCATAA
ATAAAATAATAACAATAA
FI15228.complete Blast Records
Blast to d_melanogaster_OreR.fa performed 2019-03-15 10:57:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chrX | 22417052 | chrX | 19998681..19999146 | 466..1 | 2315 | 99.8 | Minus |
chrX | 22417052 | chrX | 20029580..20029756 | 10..186 | 345 | 79.7 | Plus |
chrX | 22417052 | chrX | 20028394..20028504 | 76..186 | 285 | 83.8 | Plus |
chrX | 22417052 | chrX | 20393049..20393197 | 38..186 | 265 | 78.5 | Plus |
chrX | 22417052 | chrX | 20439680..20439828 | 38..186 | 265 | 78.5 | Plus |
chrX | 22417052 | chrX | 20124781..20124929 | 38..186 | 220 | 76.5 | Plus |
chrX | 22417052 | chrX | 20311877..20311972 | 91..186 | 195 | 80.2 | Plus |
chrX | 22417052 | chrX | 19984941..19985019 | 186..108 | 185 | 82.3 | Minus |
chr3L | 24539361 | chr3L | 18285392..18285439 | 123..76 | 180 | 91.7 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 10:57:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 20110108..20110575 | 468..1 | 2340 | 100 | Minus |
X | 23542271 | X | 20141016..20141192 | 10..186 | 345 | 79.7 | Plus |
X | 23542271 | X | 20139829..20139939 | 76..186 | 285 | 83.8 | Plus |
X | 23542271 | X | 20574262..20574410 | 38..186 | 265 | 78.5 | Plus |
X | 23542271 | X | 20527603..20527751 | 38..186 | 250 | 77.9 | Plus |
X | 23542271 | X | 20259255..20259403 | 38..186 | 220 | 76.5 | Plus |
X | 23542271 | X | 20446394..20446489 | 91..186 | 195 | 80.2 | Plus |
X | 23542271 | X | 20096394..20096472 | 186..108 | 185 | 82.3 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:01:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23527363 | X | 20118206..20118673 | 468..1 | 2340 | 100 | Minus |
X | 23527363 | X | 20147891..20148037 | 39..186 | 295 | 81 | Plus |
X | 23527363 | X | 20149188..20149290 | 84..186 | 275 | 84.4 | Plus |
X | 23527363 | X | 20559354..20559502 | 38..186 | 265 | 78.5 | Plus |
X | 23527363 | X | 20512695..20512843 | 38..186 | 250 | 77.8 | Plus |
X | 23527363 | X | 20431486..20431581 | 91..186 | 195 | 80.2 | Plus |
X | 23527363 | X | 20244346..20244428 | 38..120 | 190 | 81.9 | Plus |
X | 23527363 | X | 20104492..20104570 | 186..108 | 185 | 82.2 | Minus |
Blast to na_te.dros performed on 2019-03-15 10:57:55 has no hits.
FI15228.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 10:58:56 Download gff for
FI15228.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chrX | 19998699..19999146 | 1..448 | 99 | | Minus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-08-23 14:33:12 Download gff for
FI15228.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15323-RA | 1..294 | 100..393 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:30:54 Download gff for
FI15228.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15323-RA | 1..294 | 100..393 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:17:17 Download gff for
FI15228.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
karr-RA | 1..294 | 100..393 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-23 14:33:11 Download gff for
FI15228.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15323-RA | 1..448 | 1..448 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:30:54 Download gff for
FI15228.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15323-RA | 1..448 | 1..448 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:17:17 Download gff for
FI15228.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
karr-RA | 1..448 | 1..448 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:58:56 Download gff for
FI15228.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 20110128..20110575 | 1..448 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:58:56 Download gff for
FI15228.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 20110128..20110575 | 1..448 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:58:56 Download gff for
FI15228.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 20110128..20110575 | 1..448 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:30:54 Download gff for
FI15228.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 20004161..20004608 | 1..448 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:47:25 Download gff for
FI15228.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 20118226..20118673 | 1..448 | 100 | | Minus |
FI15228.hyp Sequence
Translation from 99 to 392
> FI15228.hyp
MAEKSNADAKASKNNKYMTSEDPEQPSESSTQKEKGSQSSESEEEYFKNV
SERFDKDIKDLKDLIALNEKECNRLLFDRLLDVIRVEIEEKLHLPKK*
FI15228.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:56:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
karr-PA | 97 | CG15323-PA | 1..97 | 1..97 | 488 | 100 | Plus |
CG42578-PA | 92 | CG42578-PA | 1..89 | 1..94 | 171 | 43.6 | Plus |
CG34332-PA | 87 | CG34332-PA | 1..84 | 1..94 | 158 | 40.4 | Plus |
CG42577-PA | 92 | CG42577-PA | 1..89 | 1..94 | 148 | 40.4 | Plus |
CG42581-PA | 85 | CG42581-PA | 2..82 | 4..94 | 142 | 38.5 | Plus |
FI15228.pep Sequence
Translation from 99 to 392
> FI15228.pep
MAEKSNADAKASKNNKYMTSEDPEQPSESSTQKEKGSQSSESEEEYFKNV
SERFDKDIKDLKDLIALNEKECNRLLFDRLLDVIRVEIEEKLHLPKK*
FI15228.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:54:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
karr-PA | 97 | CG15323-PA | 1..97 | 1..97 | 488 | 100 | Plus |
CG42578-PA | 92 | CG42578-PA | 1..89 | 1..94 | 171 | 43.6 | Plus |
CG34332-PA | 87 | CG34332-PA | 1..84 | 1..94 | 158 | 40.4 | Plus |
CG42577-PA | 92 | CG42577-PA | 1..89 | 1..94 | 148 | 40.4 | Plus |
CG42581-PA | 85 | CG42581-PA | 2..82 | 4..94 | 142 | 38.5 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:28:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM22694-PA | 114 | GM22694-PA | 1..114 | 1..97 | 273 | 51.8 | Plus |
Dsec\GM13264-PA | 114 | GM13264-PA | 1..114 | 1..97 | 273 | 51.8 | Plus |
Dsec\GM23010-PA | 108 | GM23010-PA | 1..108 | 1..97 | 265 | 52.8 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:28:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD24880-PA | 120 | GD24880-PA | 1..120 | 1..97 | 266 | 49.2 | Plus |
Dsim\GD15554-PA | 144 | GD15554-PA | 70..144 | 21..97 | 241 | 66.2 | Plus |
Dsim\GD17479-PA | 144 | GD17479-PA | 70..144 | 21..97 | 241 | 66.2 | Plus |