Clone FI15238 Report

Search the DGRC for FI15238

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:152
Well:38
Vector:pOT2
Associated Gene/TranscriptDnaJ-60-RA
Protein status:FI15238.pep: gold
Sequenced Size:805

Clone Sequence Records

FI15238.complete Sequence

805 bp assembled on 2011-08-23

GenBank Submission: BT128828.1

> FI15238.complete
AAATCAGCTGTTTTGTGTTTTGATTTTATTTTGAAAGTCCTAGTTTAAAA
TTATGCTTTCTCCGACAGATCAGCACAAATAATACTAATAAAGCTCACAA
TGCTAAGGTTGTGCCTTCCAACTCGAGCTGGATATGTGCGTAATTTCTCG
AACGACAAACCAAGAAAACCCGAAACACACTATGAAGTTTTGAATATTCG
CAATGATTGCAGCACCCGTGAAGTCCGTAATGCCTTTGTCCAGCTCTCCA
AATTGTACCACCCAGATGTTAAGAGCAATGCTGCGTGTCCGGAGCGCACA
GCCCGATTTGTTCAGATCTCCGAGGCGTACAAGACCCTGATAAAGCCGGA
GCGGAGGAGAGACTACGATGACAGCCTGCTGTGGCAGCCATCGCGCTCGG
ACCGCAGTCCCGTTGGCGAGACGGTCAATCCCGGCCAGGCGTGGGATGTG
AGGCCCAACTACGATCCCAATCCAGGACCGTACTATGGCATCCGTGGTCT
GAAGAGGGTCTCCAACTGGCAGGTGGCCGTGGTTCTGATGGCCCTAGGCT
TCGTCGGGGCACTCTTTGGCTTCACCTCCGTCAGGTCGTCCTTTAAACTG
AGTCGCCAGATCCAGGACGAAATCTCAGCAGAGGCTAATTCCCATCATGC
CGCCGTTGTGGCCGATGCCCAGAAGTACGGCAACGAGGAGCAAGTGCGTC
GTATGGTGGACCGTATGTCGCGGAGTCCTTTCAACCAGTCTTCGGCTAAG
TAATCCCATTTCCCCATTTCCTTTGGTCAAATTAAACGTGAAAGCATAAA
AAAAA

FI15238.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 10:56:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 20044596..20044927 586..255 1660 100 Minus
chr2R 21145070 chr2R 20044324..20044539 797..582 1080 100 Minus
chr2R 21145070 chr2R 20045151..20045293 143..1 715 100 Minus
chr2R 21145070 chr2R 20044980..20045098 255..137 565 98.3 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 10:56:49
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24158590..24158921 586..255 1660 100 Minus
2R 25286936 2R 24158317..24158533 798..582 1085 100 Minus
2R 25286936 2R 24159145..24159287 143..1 715 100 Minus
2R 25286936 2R 24158974..24159092 255..137 565 98.3 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:00:58
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 24159789..24160120 586..255 1660 100 Minus
2R 25260384 2R 24159516..24159732 798..582 1085 100 Minus
2R 25260384 2R 24160344..24160486 143..1 715 100 Minus
2R 25260384 2R 24160173..24160291 255..137 565 98.3 Minus
Blast to na_te.dros performed 2019-03-15 10:56:50
Subject Length Description Subject Range Query Range Score Percent Strand
Quasimodo 7387 Quasimodo QUASIMODO 7387bp Derived from P1 clones DS08479 & DS07153 by Sue Celniker, 29 March 2001. 6219..6277 69..13 109 69.5 Minus

FI15238.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 10:57:30 Download gff for FI15238.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 20044324..20044536 585..797 100 <- Minus
chr2R 20044598..20044926 256..584 100 <- Minus
chr2R 20044980..20045091 144..255 100 <- Minus
chr2R 20045151..20045293 1..143 100   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-08-23 10:18:57 Download gff for FI15238.complete
Subject Subject Range Query Range Percent Splice Strand
DnaJ-60-RC 1..654 100..753 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:30:25 Download gff for FI15238.complete
Subject Subject Range Query Range Percent Splice Strand
DnaJ-60-RA 1..654 100..753 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:16:46 Download gff for FI15238.complete
Subject Subject Range Query Range Percent Splice Strand
DnaJ-60-RA 1..654 100..753 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-23 10:18:56 Download gff for FI15238.complete
Subject Subject Range Query Range Percent Splice Strand
CG42568-RB 10..806 1..797 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:30:25 Download gff for FI15238.complete
Subject Subject Range Query Range Percent Splice Strand
CG42568-RB 26..822 1..797 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:16:46 Download gff for FI15238.complete
Subject Subject Range Query Range Percent Splice Strand
CG42568-RB 26..822 1..797 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:57:30 Download gff for FI15238.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24158318..24158530 585..797 100 <- Minus
2R 24158592..24158920 256..584 100 <- Minus
2R 24158974..24159085 144..255 100 <- Minus
2R 24159145..24159287 1..143 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:57:30 Download gff for FI15238.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24158318..24158530 585..797 100 <- Minus
2R 24158592..24158920 256..584 100 <- Minus
2R 24158974..24159085 144..255 100 <- Minus
2R 24159145..24159287 1..143 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:57:30 Download gff for FI15238.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24158318..24158530 585..797 100 <- Minus
2R 24158592..24158920 256..584 100 <- Minus
2R 24158974..24159085 144..255 100 <- Minus
2R 24159145..24159287 1..143 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:30:25 Download gff for FI15238.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 20046497..20046608 144..255 100 <- Minus
arm_2R 20046668..20046810 1..143 100   Minus
arm_2R 20045841..20046053 585..797 100 <- Minus
arm_2R 20046115..20046443 256..584 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:47:09 Download gff for FI15238.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24159535..24159747 585..797 100 <- Minus
2R 24159809..24160137 256..584 100 <- Minus
2R 24160191..24160302 144..255 100 <- Minus
2R 24160362..24160504 1..143 100   Minus

FI15238.hyp Sequence

Translation from 99 to 752

> FI15238.hyp
MLRLCLPTRAGYVRNFSNDKPRKPETHYEVLNIRNDCSTREVRNAFVQLS
KLYHPDVKSNAACPERTARFVQISEAYKTLIKPERRRDYDDSLLWQPSRS
DRSPVGETVNPGQAWDVRPNYDPNPGPYYGIRGLKRVSNWQVAVVLMALG
FVGALFGFTSVRSSFKLSRQIQDEISAEANSHHAAVVADAQKYGNEEQVR
RMVDRMSRSPFNQSSAK*

FI15238.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:52:36
Subject Length Description Subject Range Query Range Score Percent Strand
DnaJ-60-PC 217 CG42567-PC 1..217 1..217 1140 100 Plus
DnaJ-60-PA 217 CG42567-PA 1..217 1..217 1140 100 Plus
CG8476-PA 242 CG8476-PA 34..127 23..121 152 37.4 Plus

FI15238.pep Sequence

Translation from 99 to 752

> FI15238.pep
MLRLCLPTRAGYVRNFSNDKPRKPETHYEVLNIRNDCSTREVRNAFVQLS
KLYHPDVKSNAACPERTARFVQISEAYKTLIKPERRRDYDDSLLWQPSRS
DRSPVGETVNPGQAWDVRPNYDPNPGPYYGIRGLKRVSNWQVAVVLMALG
FVGALFGFTSVRSSFKLSRQIQDEISAEANSHHAAVVADAQKYGNEEQVR
RMVDRMSRSPFNQSSAK*

FI15238.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:28:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13472-PA 222 GF13472-PA 1..222 1..217 912 75.2 Plus
Dana\GF17400-PA 237 GF17400-PA 17..105 5..96 145 37 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:28:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19947-PA 368 GG19947-PA 1..198 1..198 1025 94.4 Plus
Dere\GG17072-PA 244 GG17072-PA 36..128 25..122 141 35.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 19:28:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21910-PA 215 GH21910-PA 18..215 14..217 699 61.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:34:18
Subject Length Description Subject Range Query Range Score Percent Strand
DnaJ-60-PC 217 CG42567-PC 1..217 1..217 1140 100 Plus
DnaJ-60-PA 217 CG42567-PA 1..217 1..217 1140 100 Plus
CG8476-PA 242 CG8476-PA 34..127 23..121 152 37.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 19:28:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19261-PA 215 GI19261-PA 1..215 1..217 736 62.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:29:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26049-PA 223 GL26049-PA 1..222 1..215 843 69.8 Plus
Dper\GL23136-PA 205 GL23136-PA 4..72 22..93 159 45.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:29:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25255-PA 198 GA25255-PA 2..197 20..215 839 75.5 Plus
Dpse\GA27152-PA 205 GA27152-PA 10..72 28..93 151 45.5 Plus
Dpse\GA29090-PA 205 GA29090-PA 10..72 28..93 150 45.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:29:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18265-PA 217 GM18265-PA 1..217 1..217 1151 98.6 Plus
Dsec\GM25957-PA 242 GM25957-PA 36..127 25..121 148 39.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:29:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20517-PA 242 GD20517-PA 38..127 27..121 143 38.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:29:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22136-PA 211 GJ22136-PA 17..211 14..217 748 65.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 19:29:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23194-PA 219 GK23194-PA 1..219 1..217 769 65.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:29:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11476-PA 217 GE11476-PA 1..217 1..217 1123 96.3 Plus
Dyak\GE24461-PA 244 GE24461-PA 36..127 25..121 144 37.1 Plus