Clone FI15274 Report

Search the DGRC for FI15274

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:152
Well:74
Vector:pOT2
Associated Gene/TranscriptCG44242-RB
Protein status:FI15274.pep: gold
Sequenced Size:353

Clone Sequence Records

FI15274.complete Sequence

353 bp assembled on 2011-08-24

GenBank Submission: BT128847.1

> FI15274.complete
TAACTTTTACTTTTGCCTTGGCTTTTTGGTAGAAATTCAATTGCTGTTGC
TATGGTTCGACCAACACTAGTTGCGCTGGCTAAGCGCGTACCGCTCATAC
ACTTCCGCAAGGGTGGTGCAGGAGTGCCGGGCGCCCAGACAGCAAACCAG
AAGGCAAGTTCCCAGGCCGCAGGAGGCAAAAAGTTGGCCGGTGGACCAGC
AATTGAGGACTACGAGCTGCCGGCACGATTTGCCCGCAAGCCAATTGATC
CCGAAGAGGCGGCTTACATTAATAATGGGGGTATTCCAAACTGAAGGGGC
TCTCAAAGTATGCTGCTTATAAAATATAACACATATTAATGTCAAAAAAA
AAA

FI15274.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 10:58:05
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 12083742..12083924 1..183 915 100 Plus
chr2R 21145070 chr2R 12084012..12084173 182..343 810 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 10:58:03
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16196420..16196602 1..183 915 100 Plus
2R 25286936 2R 16196690..16196852 182..344 815 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:01:09
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 16197619..16197801 1..183 915 100 Plus
2R 25260384 2R 16197889..16198051 182..344 815 100 Plus
Blast to na_te.dros performed on 2019-03-15 10:58:03 has no hits.

FI15274.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 10:59:01 Download gff for FI15274.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 12083742..12083924 1..183 100 -> Plus
chr2R 12084014..12084173 184..343 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-08-24 17:43:33 Download gff for FI15274.complete
Subject Subject Range Query Range Percent Splice Strand
CG8446-RE 1..243 52..294 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:31:04 Download gff for FI15274.complete
Subject Subject Range Query Range Percent Splice Strand
CG44242-RB 1..243 52..294 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:17:28 Download gff for FI15274.complete
Subject Subject Range Query Range Percent Splice Strand
CG44242-RB 1..243 52..294 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 17:43:32 Download gff for FI15274.complete
Subject Subject Range Query Range Percent Splice Strand
CG8446-RE 35..377 1..343 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:31:04 Download gff for FI15274.complete
Subject Subject Range Query Range Percent Splice Strand
CG44242-RB 37..379 1..343 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:17:28 Download gff for FI15274.complete
Subject Subject Range Query Range Percent Splice Strand
CG44242-RB 37..379 1..343 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:59:01 Download gff for FI15274.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16196420..16196602 1..183 100 -> Plus
2R 16196692..16196851 184..343 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:59:01 Download gff for FI15274.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16196420..16196602 1..183 100 -> Plus
2R 16196692..16196851 184..343 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:59:01 Download gff for FI15274.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16196420..16196602 1..183 100 -> Plus
2R 16196692..16196851 184..343 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:31:04 Download gff for FI15274.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12083925..12084107 1..183 100 -> Plus
arm_2R 12084197..12084356 184..343 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:47:29 Download gff for FI15274.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16197619..16197801 1..183 100 -> Plus
2R 16197891..16198050 184..343 100   Plus

FI15274.hyp Sequence

Translation from 51 to 293

> FI15274.hyp
MVRPTLVALAKRVPLIHFRKGGAGVPGAQTANQKASSQAAGGKKLAGGPA
IEDYELPARFARKPIDPEEAAYINNGGIPN*

FI15274.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:57:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG44242-PB 80 CG44242-PB 1..80 1..80 411 100 Plus
CG44242-PA 70 CG44242-PA 1..70 1..80 343 87.5 Plus

FI15274.pep Sequence

Translation from 51 to 293

> FI15274.pep
MVRPTLVALAKRVPLIHFRKGGAGVPGAQTANQKASSQAAGGKKLAGGPA
IEDYELPARFARKPIDPEEAAYINNGGIPN*

FI15274.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:29:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12180-PA 79 GF12180-PA 1..79 1..80 274 77.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:29:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20579-PA 80 GG20579-PA 1..80 1..80 390 96.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 19:29:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22779-PA 81 GH22779-PA 1..81 1..80 280 69.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:09:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG44242-PB 80 CG44242-PB 1..80 1..80 411 100 Plus
CG44242-PA 70 CG44242-PA 1..70 1..80 343 87.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 19:29:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\Tes14-PA 80 GI20576-PA 1..80 1..80 286 68.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:29:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11406-PA 82 GL11406-PA 1..82 1..80 291 78 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:29:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24712-PA 82 GA24712-PA 1..82 1..80 291 78 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:29:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21670-PA 108 GM21670-PA 73..107 45..79 181 97.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:29:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11171-PA 80 GD11171-PA 1..79 1..79 389 97.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 19:29:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17907-PA 80 GK17907-PA 1..79 1..80 259 78.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:29:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11764-PA 80 GE11764-PA 1..80 1..80 394 97.5 Plus