Clone FI15285 Report

Search the DGRC for FI15285

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:152
Well:85
Vector:pOT2
Associated Gene/TranscriptCG17977-RA
Protein status:FI15285.pep: gold
Sequenced Size:632

Clone Sequence Records

FI15285.complete Sequence

632 bp assembled on 2011-08-23

GenBank Submission: BT128824.1

> FI15285.complete
CTTTTGAAAAAAAAAACAAACAAAATCAGTTCATTTACCAAACTATGGAC
AAAATATTGCATTTGATGACAAAACATTAAGTATATTTACCCAGGCGAGC
AATGAGCACACACCAATGCCCCAAATATTCGAGTGACGACGACGTCGAGA
TATTGAAAGATGCAATGGAGGAGCTGCAAAAATAAGCTTGAAAAGATCCT
AAAAAAACCAAAATGACTTTTGCAAGGTGGAACTGGACTATTTTCCCGTG
TATGATCCCGACGAGCTTTCCAATCTGGATGCGAATCTTTCAAAGCCGGG
CAATAGCACAAAACGCTCATATTATTCACCGCATCCTGAGGCCAGAAGGT
CGAATAGAACCGCTGAAAAACAATTTGTCAAAGATGTTCAACTACGATAT
TCTCATGGCTTACAACTGCGACGGTGAGCTCTCAGTCAGCAGTCAGTCAT
CTCATACAAATATATTAACGAAACTATTTTTGGGGTCCTGAAAACAGACA
TTAAGGCGACGATATCATAAAAGAAACCACGACTTACGGAGGAGGATTAG
ACAGAACCAAAAGTGTGAGCCAGATTCTGATTGGGATTAGCCGATAAGCT
GGTATCAATGCTGCATTTCGTTTATTTGCAAC

FI15285.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 10:56:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 3954752..3955065 315..1 1525 99.7 Minus
chr2R 21145070 chr2R 3954535..3954703 483..315 845 100 Minus
chr2R 21145070 chr2R 3954019..3954173 632..478 760 99.4 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 10:56:44
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8067342..8067655 315..1 1525 99.7 Minus
2R 25286936 2R 8067125..8067293 483..315 845 100 Minus
2R 25286936 2R 8066609..8066763 632..478 760 99.4 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:00:57
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 8068541..8068854 315..1 1535 99.6 Minus
2R 25260384 2R 8068324..8068492 483..315 845 100 Minus
2R 25260384 2R 8067808..8067962 632..478 760 99.3 Minus
Blast to na_te.dros performed on 2019-03-15 10:56:45 has no hits.

FI15285.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 10:57:28 Download gff for FI15285.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 3954019..3954168 483..632 100 <- Minus
chr2R 3954536..3954703 315..482 100 <- Minus
chr2R 3954753..3955065 1..314 99   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-08-23 10:01:40 Download gff for FI15285.complete
Subject Subject Range Query Range Percent Splice Strand
CG17977-RA 1..279 213..491 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:30:20 Download gff for FI15285.complete
Subject Subject Range Query Range Percent Splice Strand
CG17977-RA 1..279 213..491 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:16:42 Download gff for FI15285.complete
Subject Subject Range Query Range Percent Splice Strand
CG17977-RA 1..279 213..491 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-23 10:01:39 Download gff for FI15285.complete
Subject Subject Range Query Range Percent Splice Strand
CG17977-RA 1..628 4..632 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:30:20 Download gff for FI15285.complete
Subject Subject Range Query Range Percent Splice Strand
CG17977-RA 1..631 1..632 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:16:42 Download gff for FI15285.complete
Subject Subject Range Query Range Percent Splice Strand
CG17977-RA 1..631 1..632 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:57:28 Download gff for FI15285.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8066609..8066758 483..632 100 <- Minus
2R 8067126..8067293 315..482 100 <- Minus
2R 8067343..8067655 1..314 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:57:28 Download gff for FI15285.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8066609..8066758 483..632 100 <- Minus
2R 8067126..8067293 315..482 100 <- Minus
2R 8067343..8067655 1..314 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:57:28 Download gff for FI15285.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8066609..8066758 483..632 100 <- Minus
2R 8067126..8067293 315..482 100 <- Minus
2R 8067343..8067655 1..314 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:30:20 Download gff for FI15285.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3954114..3954263 483..632 100 <- Minus
arm_2R 3954631..3954798 315..482 100 <- Minus
arm_2R 3954848..3955160 1..314 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:47:06 Download gff for FI15285.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8068542..8068854 1..314 99   Minus
2R 8067808..8067957 483..632 100 <- Minus
2R 8068325..8068492 315..482 100 <- Minus

FI15285.hyp Sequence

Translation from 212 to 490

> FI15285.hyp
MTFARWNWTIFPCMIPTSFPIWMRIFQSRAIAQNAHIIHRILRPEGRIEP
LKNNLSKMFNYDILMAYNCDGELSVSSQSSHTNILTKLFLGS*

FI15285.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:51:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG17977-PA 92 CG17977-PA 1..92 1..92 493 100 Plus

FI15285.pep Sequence

Translation from 212 to 490

> FI15285.pep
MTFARWNWTIFPCMIPTSFPIWMRIFQSRAIAQNAHIIHRILRPEGRIEP
LKNNLSKMFNYDILMAYNCDGELSVSSQSSHTNILTKLFLGS*

FI15285.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:27:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10682-PA 146 GG10682-PA 85..126 30..71 186 78.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:51:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG17977-PA 92 CG17977-PA 1..92 1..92 493 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:27:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20729-PA 851 GM20729-PA 86..122 35..71 191 94.6 Plus