Clone FI15501 Report

Search the DGRC for FI15501

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:155
Well:1
Vector:pOTB7_DraIII
Associated Gene/TranscriptCG15308-RB
Protein status:FI15501.pep: gold
Sequenced Size:440

Clone Sequence Records

FI15501.complete Sequence

440 bp assembled on 2011-10-10

GenBank Submission: BT132676.1

> FI15501.complete
TCCTCCAAGCACAACTTACTCAAAAAGAACAAAGTTTGGAAACATGAAGT
TCTTCATCGCCGCCTTCCTGATCGCCGCCTGCATGGCCCTCGCCCAGTGC
AGTGTCATCTACTCGCCGGTGTCCTCCGTTCCGGTGGTCCGTTCCGTGCC
CGTTATTCGCTCCGTTCCGGTGGTGCGCAGTGTGCCTGTGGTCCGCCGTG
TGCCGGTGGTTCGCCGTGTCAATGTGGTCGAGTCCGTTCCAGTGGTGCCC
TCGGTGGTGCGCGTTGGACAGGCCCCCATCTACGATGCTCCACTGGTGCA
GTCCTATGGTGGATGGTTGAAGCAGAAGTAGATGGATGCCACGAGAAAGG
ATACCACTACATGTACTTTTGATGTGAAATAAACTTTGAATAGAACGAAC
AAATATATACTAGCAAAACTCAAAAAAAAAAAAAAAAAAA

FI15501.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:16:06
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 10109625..10109998 421..48 1825 99.2 Minus
chrX 22417052 chrX 10110700..10110748 49..1 245 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:16:04
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 10218003..10218379 424..48 1885 100 Minus
X 23542271 X 10219073..10219121 49..1 245 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:15:14
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 10226101..10226477 424..48 1885 100 Minus
X 23527363 X 10227171..10227219 49..1 245 100 Minus
Blast to na_te.dros performed on 2019-03-15 11:16:05 has no hits.

FI15501.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:17:01 Download gff for FI15501.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 10109625..10109996 50..421 99 <- Minus
chrX 10110700..10110748 1..49 100   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-10-10 14:49:22 Download gff for FI15501.complete
Subject Subject Range Query Range Percent Splice Strand
CG15308-RB 1..288 44..331 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:41:10 Download gff for FI15501.complete
Subject Subject Range Query Range Percent Splice Strand
CG15308-RB 1..288 44..331 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:28:00 Download gff for FI15501.complete
Subject Subject Range Query Range Percent Splice Strand
CG15308-RB 1..288 44..331 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-10-10 14:49:22 Download gff for FI15501.complete
Subject Subject Range Query Range Percent Splice Strand
CG15308-RB 1..367 2..368 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:41:10 Download gff for FI15501.complete
Subject Subject Range Query Range Percent Splice Strand
CG15308-RB 19..439 1..421 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:28:00 Download gff for FI15501.complete
Subject Subject Range Query Range Percent Splice Strand
CG15308-RB 19..439 1..421 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:17:01 Download gff for FI15501.complete
Subject Subject Range Query Range Percent Splice Strand
X 10218006..10218377 50..421 100 <- Minus
X 10219073..10219121 1..49 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:17:01 Download gff for FI15501.complete
Subject Subject Range Query Range Percent Splice Strand
X 10218006..10218377 50..421 100 <- Minus
X 10219073..10219121 1..49 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:17:01 Download gff for FI15501.complete
Subject Subject Range Query Range Percent Splice Strand
X 10218006..10218377 50..421 100 <- Minus
X 10219073..10219121 1..49 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:41:10 Download gff for FI15501.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 10112039..10112410 50..421 100 <- Minus
arm_X 10113106..10113154 1..49 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:36:43 Download gff for FI15501.complete
Subject Subject Range Query Range Percent Splice Strand
X 10226104..10226475 50..421 100 <- Minus
X 10227171..10227219 1..49 100   Minus

FI15501.hyp Sequence

Translation from 0 to 371

> FI15501.hyp
SSKHNLLKKNKVWKHEVLHRRLPDRRLHGPRPVQCHLLAGVLRSGGPFRA
RYSLRSGGAQCACGPPCAGGSPCQCGRVRSSGALGGARWTGPHLRCSTGA
VLWWMVEAEVDGCHEKGYHYMYF*
Sequence FI15501.hyp has no blast hits.

FI15501.pep Sequence

Translation from 1 to 330

> FI15501.pep
PPSTTYSKRTKFGNMKFFIAAFLIAACMALAQCSVIYSPVSSVPVVRSVP
VIRSVPVVRSVPVVRRVPVVRRVNVVESVPVVPSVVRVGQAPIYDAPLVQ
SYGGWLKQK*

FI15501.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 23:17:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18941-PA 102 GG18941-PA 1..102 15..109 140 82.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:20:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG15308-PB 95 CG15308-PB 1..95 15..109 470 100 Plus
CG15308-PC 82 CG15308-PC 1..82 28..109 405 100 Plus
CG34268-PA 83 CG34268-PA 5..70 19..84 140 48.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 23:17:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13118-PA 96 GL13118-PA 1..96 15..109 221 67.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 23:17:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22484-PA 96 GA22484-PA 1..96 15..109 221 67.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 23:17:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11332-PA 95 GM11332-PA 1..95 15..109 186 88.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 23:17:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24652-PA 95 GD24652-PA 1..95 15..109 165 91.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 23:17:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18768-PA 255 GJ18768-PA 158..254 14..109 140 52.8 Plus