Clone FI15737 Report

Search the DGRC for FI15737

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:157
Well:37
Vector:pCR2.1
Associated Gene/TranscriptCG11269-RA
Protein status:FI15737.pep: gold
Sequenced Size:606

Clone Sequence Records

FI15737.complete Sequence

606 bp assembled on 2011-08-26

GenBank Submission: BT128852.1

> FI15737.complete
GTACTTGTGTACGAGCGTATGTAGATAGATGGATGAATAGTATGTGGTCC
AATACATTCCGATTTCGATTTCGGATTCGGTTTCGCTTTCGAAGTCGGCT
TAAACTTGGCACCTGTTGCGGTCAGAGCAACACTCGACTACACTGTCGCA
CAAAGTTCGCATAGAATTGAATCGAGCTTGAAAATGTTTTGTGGTCGCAA
GTGCTGTCTGTTCTGCCTGTTCATGAGCGCCTGGGGCTTCTTGATGCTGA
ATCTGCTGGGTATCTTCTTCTACGTCCAGTCACTGATGCTCCTGGAGTCC
CTGCCCTTGCCCCACCACTTCCCCAGTCAGGAGGCCTTCAAGGAGCAGGC
GGACGAGGCCTACCAGGACGTGTCCACACGGTGCTTTGTAGCCGCCGTTT
TCTATCTGGGATTCGTCTTCATTGCGATAGTGGCCATTCGTCGGGATAAC
AAGAGAAGGAAGCGACTCTACAAGCGGGGTCCCGGTCACTTGCGATTCCG
TCGTTGATTTGTATGATTGGTTATTGAATAAACAATTTATTTTCATGGTT
CCAATTGCATTTCACCCACTCAGCGACGTCCACCCACTTGTTGGTTCGAA
AGATCG

FI15737.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 10:58:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 18025206..18025818 1..606 2865 98.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 10:58:14
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 22138759..22139364 1..606 3030 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:00:31
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 22139958..22140563 1..606 3030 100 Plus
Blast to na_te.dros performed 2019-03-15 10:58:15
Subject Length Description Subject Range Query Range Score Percent Strand
S2 1735 S2 S2 1735bp 1662..1717 500..554 106 67.9 Plus

FI15737.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 10:59:07 Download gff for FI15737.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 18025206..18025818 1..606 98   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-08-26 15:07:19 Download gff for FI15737.complete
Subject Subject Range Query Range Percent Splice Strand
CG11269-RA 1..324 184..507 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:31:14 Download gff for FI15737.complete
Subject Subject Range Query Range Percent Splice Strand
CG11269-RA 1..324 184..507 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:17:40 Download gff for FI15737.complete
Subject Subject Range Query Range Percent Splice Strand
CG11269-RA 1..324 184..507 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-26 15:07:19 Download gff for FI15737.complete
Subject Subject Range Query Range Percent Splice Strand
CG11269-RA 1..324 184..507 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:31:14 Download gff for FI15737.complete
Subject Subject Range Query Range Percent Splice Strand
CG11269-RA 1..401 137..537 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:17:40 Download gff for FI15737.complete
Subject Subject Range Query Range Percent Splice Strand
CG11269-RA 1..401 137..537 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:59:07 Download gff for FI15737.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22138759..22139364 1..606 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:59:07 Download gff for FI15737.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22138759..22139364 1..606 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:59:07 Download gff for FI15737.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22138759..22139364 1..606 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:31:14 Download gff for FI15737.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18026264..18026869 1..606 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:46:16 Download gff for FI15737.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22139958..22140563 1..606 100   Plus

FI15737.hyp Sequence

Translation from 183 to 506

> FI15737.hyp
MFCGRKCCLFCLFMSAWGFLMLNLLGIFFYVQSLMLLESLPLPHHFPSQE
AFKEQADEAYQDVSTRCFVAAVFYLGFVFIAIVAIRRDNKRRKRLYKRGP
GHLRFRR*

FI15737.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:57:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG11269-PA 107 CG11269-PA 1..107 1..107 573 100 Plus
CG40127-PA 95 CG40127-PA 4..76 3..75 156 41.1 Plus
CG40127-PB 95 CG40127-PB 4..76 3..75 156 41.1 Plus

FI15737.pep Sequence

Translation from 183 to 506

> FI15737.pep
MFCGRKCCLFCLFMSAWGFLMLNLLGIFFYVQSLMLLESLPLPHHFPSQE
AFKEQADEAYQDVSTRCFVAAVFYLGFVFIAIVAIRRDNKRRKRLYKRGP
GHLRFRR*

FI15737.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:29:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11647-PA 110 GF11647-PA 1..102 1..100 277 50 Plus
Dana\GF13846-PA 95 GF13846-PA 3..76 2..75 150 37.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:29:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22165-PA 103 GG22165-PA 1..97 1..97 454 86.6 Plus
Dere\GG21385-PA 95 GG21385-PA 3..76 2..75 154 40.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 19:29:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20554-PA 107 GH20554-PA 4..95 2..93 180 35.9 Plus
Dgri\GH20457-PA 95 GH20457-PA 3..76 2..75 166 41.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:19:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG11269-PA 107 CG11269-PA 1..107 1..107 573 100 Plus
RNASEK-PA 95 CG40127-PA 4..76 3..75 156 41.1 Plus
RNASEK-PB 95 CG40127-PB 4..76 3..75 156 41.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 19:29:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18823-PA 112 GI18823-PA 1..99 1..100 193 37 Plus
Dmoj\GI18882-PA 95 GI18882-PA 3..76 2..75 134 39.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:29:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11780-PA 102 GL11780-PA 1..94 1..94 232 46.8 Plus
Dper\GL11056-PA 95 GL11056-PA 3..76 2..75 154 40.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:29:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10879-PA 102 GA10879-PA 1..94 1..94 232 46.8 Plus
Dpse\GA24591-PA 95 GA24591-PA 3..76 2..75 154 40.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:29:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15886-PA 107 GM15886-PA 1..107 1..107 549 97.2 Plus
Dsec\GM11704-PA 95 GM11704-PA 3..76 2..75 154 40.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:29:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11649-PA 107 GD11649-PA 1..107 1..107 551 98.1 Plus
Dsim\GD17680-PA 95 GD17680-PA 3..76 2..75 154 40.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:29:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21850-PA 108 GJ21850-PA 5..93 3..91 207 41.6 Plus
Dvir\GJ21916-PA 95 GJ21916-PA 3..76 2..75 167 40.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 19:29:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19636-PA 134 GK19636-PA 1..95 1..93 221 42.1 Plus
Dwil\GK10758-PA 95 GK10758-PA 3..76 2..75 160 40.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:29:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14158-PA 105 GE14158-PA 1..100 1..100 446 83 Plus
Dyak\GE22683-PA 95 GE22683-PA 3..76 2..75 154 40.5 Plus