![]() | BDGP Sequence Production Resources |
Search the DGRC for FI15750
Library: | FI |
Tissue Source: | various Drosophila melanogaster |
Created by: | |
Date Registered: | 2005-11-08 |
Comments: | Drosophila melanogaster corrected cDNA clones |
Original Plate Number: | 157 |
Well: | 50 |
Vector: | pCR2.1 |
Associated Gene/Transcript | CG13086-RA |
Protein status: | FI15750.pep: gold |
Sequenced Size: | 610 |
610 bp assembled on 2011-08-26
GenBank Submission: BT128856.1
> FI15750.complete ATGCCGAATCGCGCGACGCGGAAGAAATATCGCCGGATTCGACTCCACAT TTTCCTGGCATTATCCCTATGGTTCCTGATCGAGGCTCATCCCGTCGAAG GAACACGGTGCAGGAATCCCTATGAGAGGGTACGGGAAAACTATTGCTAC TTCGTTGCTGACGAGGAACCGCTGCACACATCGTTCCATAACTTTTGCTA TCAGGACAAGCGCACCTCACGAGTTTGCCTGGATAGTGACGAGGAAATGC GCGTTCTGGCCCATCACCTGGCCAACTTGGGCTACCCGAACGGCACGCAG TTCTGGAGCGCCGGGCATCGATGGCCGGGTGATAACCGCTTCTACTGGAA CTACTTTGGCAGAGCCCGACCGCTCAACTACTCCAACTGGGCGGTGGACG AGCCGACGCCCCAAATGGGCCGCAATTGCCTGATCCTCACTCTCCAGGGT GGAGAACTCATCATGAGCAGTGAGTCCTGCTACACCCGAGCGGTCGATAT CTGCGAACAGACGCTGAACGGCACGGATTCCCGTCCCGTAATCCACTGAT CGCCAGATATTTATGTATCTCAATATCTACTAAAGTACCTAGCAAAACAA AACCCAAATA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 19362935..19363108 | 1..174 | 99 | -> | Plus |
chr2L | 19363513..19363947 | 175..609 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13086-RA | 1..549 | 1..549 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13086-RA | 1..549 | 1..549 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13086-RA | 1..549 | 1..549 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13086-RA | 1..598 | 1..598 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13086-RB | 20..628 | 1..609 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13086-RB | 20..628 | 1..609 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 19364394..19364567 | 1..174 | 100 | -> | Plus |
2L | 19364974..19365408 | 175..609 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 19364394..19364567 | 1..174 | 100 | -> | Plus |
2L | 19364974..19365408 | 175..609 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 19364394..19364567 | 1..174 | 100 | -> | Plus |
2L | 19364974..19365408 | 175..609 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 19364394..19364567 | 1..174 | 100 | -> | Plus |
arm_2L | 19364974..19365408 | 175..609 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 19364974..19365408 | 175..609 | 100 | Plus | |
2L | 19364394..19364567 | 1..174 | 100 | -> | Plus |
Translation from 0 to 548
> FI15750.pep MPNRATRKKYRRIRLHIFLALSLWFLIEAHPVEGTRCRNPYERVRENYCY FVADEEPLHTSFHNFCYQDKRTSRVCLDSDEEMRVLAHHLANLGYPNGTQ FWSAGHRWPGDNRFYWNYFGRARPLNYSNWAVDEPTPQMGRNCLILTLQG GELIMSSESCYTRAVDICEQTLNGTDSRPVIH*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF14713-PA | 372 | GF14713-PA | 1..182 | 1..182 | 744 | 74.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG21170-PA | 182 | GG21170-PA | 1..182 | 1..182 | 911 | 91.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH13444-PA | 174 | GH13444-PA | 28..174 | 34..182 | 570 | 68.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13086-PB | 182 | CG13086-PB | 1..182 | 1..182 | 1019 | 100 | Plus |
CG13086-PA | 182 | CG13086-PA | 1..182 | 1..182 | 1019 | 100 | Plus |
CG13086-PC | 167 | CG13086-PC | 1..167 | 1..182 | 909 | 91.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI14006-PA | 176 | GI14006-PA | 1..169 | 1..173 | 610 | 65.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL21199-PA | 182 | GL21199-PA | 1..182 | 1..182 | 694 | 71 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12036-PA | 349 | GA12036-PA | 1..172 | 1..173 | 689 | 72.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM17337-PA | 182 | GM17337-PA | 1..182 | 1..182 | 973 | 97.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD24195-PA | 182 | GD24195-PA | 1..182 | 1..182 | 970 | 97.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ18250-PA | 173 | GJ18250-PA | 25..173 | 32..182 | 579 | 67.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK23828-PA | 178 | GK23828-PA | 1..178 | 1..182 | 663 | 68.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE13243-PA | 182 | GE13243-PA | 1..182 | 1..182 | 926 | 92.9 | Plus |
Translation from 1 to 548
> FI15750.hyp MPNRATRKKYRRIRLHIFLALSLWFLIEAHPVEGTRCRNPYERVRENYCY FVADEEPLHTSFHNFCYQDKRTSRVCLDSDEEMRVLAHHLANLGYPNGTQ FWSAGHRWPGDNRFYWNYFGRARPLNYSNWAVDEPTPQMGRNCLILTLQG GELIMSSESCYTRAVDICEQTLNGTDSRPVIH*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13086-PB | 182 | CG13086-PB | 1..182 | 1..182 | 1019 | 100 | Plus |
CG13086-PA | 182 | CG13086-PA | 1..182 | 1..182 | 1019 | 100 | Plus |
CG13086-PC | 167 | CG13086-PC | 1..167 | 1..182 | 909 | 91.8 | Plus |