Clone FI15773 Report

Search the DGRC for FI15773

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:157
Well:73
Vector:pCR2.1
Associated Gene/TranscriptNpc2c-RA
Protein status:FI15773.pep: gold
Sequenced Size:701

Clone Sequence Records

FI15773.complete Sequence

701 bp assembled on 2011-08-26

GenBank Submission: BT128853.1

> FI15773.complete
CAAACCAGCTACCAAAACCCCGAGAAAAATGTCCAGCTTCAAGAAGTTAT
CCCTGTGCCTAGTGCTTTCTATCATGTGGACCTCGGTTGCAGACAGCACG
CCAATTAGACAATGTGCCGACAGCAACTATCCTCAGCCACTGATGGTGCA
AATCGACGATTGTGACGCATTGCCCTGCGATTTGTGGAAGGGAACCGAGG
CCAAAATCGACATCCAATTTGTTGCCACTCGCAATACCATGAAGAAGCTA
TCAGCCGAAGTGCATCTGACCTCGCTGGGAGTGACCATACCCTATGACCT
AGAAGCCTCCCGTGGCAATGTGTGCAGCAATCTGCTCCATGGCGCCTACT
GTCCCCTGGATGCTGGCGAGGATGTGACCTACCAGCTGCTCCTGCCAGTC
ACCACCAACCAGCCGGAGGTGCCCACGCGCCTAGAAGTTCGTCTGCTGGA
CTCCGATGACGAGAATCGAGTGGTGTCCTGTTTCCTGGCCGACACTCGGG
TCAAGAAGCCCAGATCGGCAGTTTAGATGAAGATGACTTATAGATTAGGC
CGCAAGACATTGTATCAATGTTTTTGGCACTGGACATCGAGTGATGCCAA
TTAATACCGCATAAGCAGTTGGCACTTAAGCCCGACAAACACTATTAGCA
GTTATGAATAAATAATTAGGGGAAAATATTATAAATAATCGAAAAAAAAA
A

FI15773.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 10:58:25
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 5886442..5886905 228..691 2320 100 Plus
chr3R 27901430 chr3R 5886038..5886153 1..116 580 100 Plus
chr3R 27901430 chr3R 5886214..5886327 114..227 570 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 10:58:23
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 10060673..10061139 228..694 2335 100 Plus
3R 32079331 3R 10060269..10060384 1..116 580 100 Plus
3R 32079331 3R 10060445..10060558 114..227 570 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:00:33
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 9801504..9801970 228..694 2335 100 Plus
3R 31820162 3R 9801100..9801215 1..116 580 100 Plus
3R 31820162 3R 9801276..9801389 114..227 570 100 Plus
Blast to na_te.dros performed on 2019-03-15 10:58:23 has no hits.

FI15773.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 10:59:11 Download gff for FI15773.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 5886038..5886150 1..113 100 -> Plus
chr3R 5886214..5886327 114..227 100 -> Plus
chr3R 5886442..5886905 228..691 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-08-26 15:13:00 Download gff for FI15773.complete
Subject Subject Range Query Range Percent Splice Strand
Npc2c-RA 1..498 29..526 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:31:24 Download gff for FI15773.complete
Subject Subject Range Query Range Percent Splice Strand
Npc2c-RA 1..498 29..526 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:17:47 Download gff for FI15773.complete
Subject Subject Range Query Range Percent Splice Strand
Npc2c-RA 1..498 29..526 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-26 15:13:00 Download gff for FI15773.complete
Subject Subject Range Query Range Percent Splice Strand
Npc2c-RA 1..663 29..691 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:31:24 Download gff for FI15773.complete
Subject Subject Range Query Range Percent Splice Strand
Npc2c-RA 18..708 1..691 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:17:47 Download gff for FI15773.complete
Subject Subject Range Query Range Percent Splice Strand
Npc2c-RA 18..708 1..691 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:59:11 Download gff for FI15773.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10060269..10060381 1..113 100 -> Plus
3R 10060445..10060558 114..227 100 -> Plus
3R 10060673..10061136 228..691 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:59:11 Download gff for FI15773.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10060269..10060381 1..113 100 -> Plus
3R 10060445..10060558 114..227 100 -> Plus
3R 10060673..10061136 228..691 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:59:11 Download gff for FI15773.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10060269..10060381 1..113 100 -> Plus
3R 10060445..10060558 114..227 100 -> Plus
3R 10060673..10061136 228..691 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:31:24 Download gff for FI15773.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5885991..5886103 1..113 100 -> Plus
arm_3R 5886167..5886280 114..227 100 -> Plus
arm_3R 5886395..5886858 228..691 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:46:20 Download gff for FI15773.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9801504..9801967 228..691 100   Plus
3R 9801100..9801212 1..113 100 -> Plus
3R 9801276..9801389 114..227 100 -> Plus

FI15773.hyp Sequence

Translation from 0 to 525

> FI15773.hyp
KPATKTPRKMSSFKKLSLCLVLSIMWTSVADSTPIRQCADSNYPQPLMVQ
IDDCDALPCDLWKGTEAKIDIQFVATRNTMKKLSAEVHLTSLGVTIPYDL
EASRGNVCSNLLHGAYCPLDAGEDVTYQLLLPVTTNQPEVPTRLEVRLLD
SDDENRVVSCFLADTRVKKPRSAV*

FI15773.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:57:16
Subject Length Description Subject Range Query Range Score Percent Strand
Npc2c-PA 165 CG3934-PA 1..165 10..174 860 100 Plus
Npc2e-PB 168 CG31410-PB 2..154 16..173 265 35.4 Plus
Npc2d-PA 173 CG12813-PA 9..159 16..169 245 37.8 Plus

FI15773.pep Sequence

Translation from 1 to 525

> FI15773.pep
KPATKTPRKMSSFKKLSLCLVLSIMWTSVADSTPIRQCADSNYPQPLMVQ
IDDCDALPCDLWKGTEAKIDIQFVATRNTMKKLSAEVHLTSLGVTIPYDL
EASRGNVCSNLLHGAYCPLDAGEDVTYQLLLPVTTNQPEVPTRLEVRLLD
SDDENRVVSCFLADTRVKKPRSAV*

FI15773.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:30:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17856-PA 164 GF17856-PA 1..164 10..173 729 81.1 Plus
Dana\GF17855-PA 170 GF17855-PA 8..161 16..173 275 36.7 Plus
Dana\GF17854-PA 164 GF17854-PA 2..155 16..173 269 35.4 Plus
Dana\GF17136-PA 175 GF17136-PA 9..162 16..173 260 37.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:30:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17335-PA 165 GG17335-PA 1..164 10..173 820 95.1 Plus
Dere\GG17324-PA 168 GG17324-PA 6..154 16..173 269 36.1 Plus
Dere\GG17305-PA 172 GG17305-PA 25..162 32..173 250 37.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 19:30:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14244-PA 204 GH14244-PA 11..161 19..169 577 64.2 Plus
Dgri\GH14070-PA 149 GH14070-PA 3..142 32..174 247 41.4 Plus
Dgri\GH14243-PA 293 GH14243-PA 149..280 41..174 247 35.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:27:28
Subject Length Description Subject Range Query Range Score Percent Strand
Npc2c-PA 165 CG3934-PA 1..165 10..174 860 100 Plus
Npc2e-PB 168 CG31410-PB 2..154 16..173 265 35.4 Plus
Npc2d-PA 173 CG12813-PA 9..159 16..169 245 37.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 19:30:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23137-PA 162 GI23137-PA 8..161 16..169 560 65.6 Plus
Dmoj\GI23136-PA 169 GI23136-PA 18..155 32..173 271 38.7 Plus
Dmoj\GI24446-PA 175 GI24446-PA 9..162 16..169 250 37.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:30:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27203-PA 164 GL27203-PA 1..163 10..172 710 79.8 Plus
Dper\GL27202-PA 172 GL27202-PA 16..154 31..173 296 38.5 Plus
Dper\GL27280-PA 162 GL27280-PA 4..157 15..169 245 36.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:30:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17784-PA 164 GA17784-PA 1..163 10..172 705 79.1 Plus
Dpse\GA16235-PA 172 GA16235-PA 17..154 32..173 303 39.4 Plus
Dpse\GA11826-PA 162 GA11826-PA 4..157 15..169 241 35.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:30:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18752-PA 165 GM18752-PA 1..165 10..174 840 95.2 Plus
Dsec\GM19612-PA 140 GM19612-PA 5..140 39..174 696 95.6 Plus
Dsec\GM23855-PA 95 GM23855-PA 1..95 80..174 478 94.7 Plus
Dsec\GM23854-PA 168 GM23854-PA 2..154 16..173 265 34.8 Plus
Dsec\GM26189-PA 169 GM26189-PA 26..163 32..173 250 37.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:30:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18663-PA 165 GD18663-PA 1..165 10..174 845 95.8 Plus
Dsim\GD18662-PA 168 GD18662-PA 2..154 16..173 268 35.4 Plus
Dsim\GD11029-PA 792 GD11029-PA 644..778 37..173 255 37.2 Plus
Dsim\GD20738-PA 172 GD20738-PA 25..162 32..173 246 37.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:30:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10438-PA 162 GJ10438-PA 8..162 16..170 602 70.3 Plus
Dvir\GJ10723-PA 176 GJ10723-PA 29..166 32..173 243 37.1 Plus
Dvir\GJ10437-PA 135 GJ10437-PA 1..103 69..173 191 36.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 19:30:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10876-PA 163 GK10876-PA 1..163 10..173 625 68.9 Plus
Dwil\GK10874-PA 169 GK10874-PA 7..152 20..169 273 32.7 Plus
Dwil\GK12205-PA 172 GK12205-PA 9..158 16..169 271 39.4 Plus
Dwil\GK12204-PA 172 GK12204-PA 9..158 16..169 264 38.1 Plus
Dwil\GK10875-PA 153 GK10875-PA 2..152 16..170 248 31.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:30:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26006-PA 165 GE26006-PA 1..164 10..173 825 93.9 Plus
Dyak\GE26005-PA 168 GE26005-PA 2..154 16..173 268 35.4 Plus
Dyak\GE24707-PA 172 GE24707-PA 25..162 32..173 245 37.8 Plus